Текст
                    Asylum
and Migration
Glossary 10.0
A tool for better comparability produced
by the European Migration Network
2025


Disclaimer This EMN Glossary has been developed by the European Migration Network (EMN). The European Commission and the EMN National Contact Points, which collectively constitute the EMN, accept no responsibility or liability whatsoever with regard to the use made of the information contained in this Glossary or of the content of the websites from which some terms are extracted. Reproduction is authorised, except for commercial purposes, provided the source is acknowledged and the following text accompanies any reproduction: ‘This EMN Glossary has been developed by the European Migration Network (EMN). The European Commission and the National Contact Points, which collectively constitute the EMN, accept no responsibility or liability whatsoever with regard to the use made of the information contained in this Glossary or of the content of the websites from which some terms are extracted.’ The European Migration Network serves to meet the information needs of European Union institutions and of Member States’ authorities and institutions by providing up-to-date, objective, reliable and comparable information on asylum and migration, with a view to supporting policy-making in the European Union in these areas. The EMN also serves to provide the general public with such information. Further information on the EMN, including its other outputs, as well as this Glossary, may be obtained from www.ec.europa.eu/emn 2 EMN ASYLUM AND MIGRATION GLOSSARY 10.0
Table of contents Foreword 4 Introduction 5 The European Migration Network 7 Method and approach followed for developing the EMN glossary Scope of the EMN glossary Processes followed for updating the EMN glossary Hierarchy of sources for defining terms Definitions Preferred terms and synonyms 8 8 8 9 9 10 Format of the EMN glossary Order of terms Nominal agreement and gender neutrality in the EMN glossary Use of ISO standards for listing EU Member States and EU languages Source of information of notes Translations Relationships between terms References to other terms in the EMN glossary References to other sources 11 11 11 11 11 11 12 12 12 Glossary 13 English index 626 List of synonyms 634 List of synonyms (referenced) 640 EMN ASYLUM AND MIGRATION GLOSSARY 10.0 3
Foreword The European Migration Network (EMN) Glossary on Asylum and Migration is one of the key outputs of the EMN since its creation in 2008. The EMN Glossary, which covers all aspects of migration and asylum, supports policymaking and practitioners across the EU and at national level by providing a common vocabulary of up-to-date terms and concepts, which have been translated into 26 national languages, allowing for a better understanding and comparability of migration and asylum phenomena. This latest edition of the EMN Glossary includes terminology that reflects developments since the publication of the Pact on Migration and Asylum in 2020. The EMN Glossary and Thesaurus Working Group is currently working on a significant update in the context of the adoption of the Pact on Migration and Asylum in May 2024. These updates will ensure full alignment with terminology related to the implementation of the Pact. While maintaining its focus on legal developments within the framework of the EU acquis on migration and asylum, the EMN Glossary also increasingly encompasses considerations of the external dimension, while also addressing the operational needs of field practitioners. The EMN, coordinated by the European Commission, supports the EU in better responding to challenges in key areas of migration and asylum. The EMN provides policymakers and the wider public with up-to-date, objective, reliable and comparable information on all aspects of migration and asylum and helps to facilitate coherent discussions with all actors in this field. The EMN is active in its EMN Member Countries (all EU Member States except Denmark) and has welcomed several Observer Countries, Norway, Georgia, the Republic of Moldova, Ukraine, Montenegro, Armenia, Serbia, North Macedonia and Albania. A clear result of this increased collaboration with the EMN Observer Countries is the addition of translations of glossary terms into Georgian, Ukrainian, and Armenian. Additionally, the EMN is working with various European and international partners as well as Commission bodies, ESTAT, JRC, DG HOME, EU agencies such as Frontex, EUAA, FRA, the European Council, the Council of Europe, the International Organization for Migration (IOM), the Organisation for Economic Co-operation and Development (OECD). Several of these partners are actively involved in the work conducted on the EMN Glossary. The EMN also cooperates with EU Council institutions which participate in the EU’s terminology database (IATE - Interactive Terminology for Europe), such as the Council of the EU, the Translation Centre for the Bodies of the EU or the Court of Justice of the EU. The EMN Glossary is not only available in a printed version but will also be available for download as a mobile app, thus increasing user friendliness and reflecting the growing number of users accessing the EMN Glossary by mobile devices. Furthermore, an online version of the Glossary, which is regularly updated, is available on the EMN website. The EMN Glossary is a valuable source of information on all aspects of migration and asylum. It goes beyond the typical scope of a glossary, as it contains useful notes further explaining more than 540 concepts that are relevant in the field of migration and asylum and is updated in response to current developments. I would like to express my sincere gratitude to all members of the EMN Glossary and Thesaurus Working Group. Their outstanding commitment to this activity has contributed to the success of the EMN overall. Magnus Ovilius EMN Chair Directorate-General for Migration and Home Affairs European Commission 4 EMN ASYLUM AND MIGRATION GLOSSARY 10.0
Introduction The purpose of the European Migration Network (EMN) glossary is to provide EU harmonised terminology in the field of migration and asylum. It ensures comparability and a common understanding of concepts between EU Member States and EU institutions. The EMN glossary is thus an essential European reference document for EMN National Contact Points (NCPs) and their national network members, policymakers and other practitioners in the EU Member States, as well as EU institutions, in order to facilitate the exchange of information. It intends to make communication easier for policymakers, practitioners, media and people interested in the topic of migration. Version 10.0 of the EMN Glossary on Asylum and Migration is the latest version, updated in December 2023. The EMN glossary was first published in January 2010 and has since been updated and expanded at regular intervals.1 Version 10.0 of the EMN glossary includes approximately 540 terms and concepts reflecting the most recent EU policy on migration and asylum. Amendments to existing entries reflect new concepts and terminology, as well as evolutions in the usage of existing terms that have been introduced through new legislation and policy on asylum and migration in the EU. The new and updated terms reflect all developments since the publication of the New Pact on Migration and Asylum in 2020.2 While maintaining its focus on legal developments in the framework of the EU acquis on asylum and migration, the EMN glossary also increasingly considers developments in the external dimension of the EU’s policy on asylum and migration, at the same time acknowledging the needs of practitioners working in the field. As in the past, it also considers the terminology used in recent EMN publications amongst other key documents. 1 2 3 Language versions available in the Glossary App include Finnish, French, German, Greek, Italian, and Latvian. Each glossary entry is comprised of a preferred term,3 a definition of the concept that this term represents, the source/sources of the definition, plus notes and relationships to other terms and concepts included in the glossary. In this tenth version, some definitions and some preferred terms have thus been amended. Many notes have been updated – and in many cases elaborated – to provide up-to-date information, to clarify the scope of the concept (and its understanding in different contexts) and to indicate online resources from which further information can be sought. Each glossary entry illustrates relationships between terms – equivalence relations between synonyms, hierarchical relations with terms representing broader or narrower terms and associative relations between related terms, thus allowing users to easily navigate between related entries. For this English edition, the preferred terms are also listed in an index at the end of the EMN glossary. The EMN glossary is developed and regularly updated by a dedicated EMN Glossary and Thesaurus Working Group (GTWG) that collaborates with key EU agencies and networks such as the European Union Agency for Asylum (EUAA), the European Union Agency for Fundamental Rights (FRA), the European Border and Coast Guard Agency (Frontex), the European Integration Network (EIN) and international organisations, such as the United Nations High Commissioner for Refugees (UNHCR), the International Organization for Migration (IOM), the International Labour Organisation (ILO) and the Organisation for Economic Cooperation and Development (OECD). The EMN also cooperates with EU Council institutions which participate in The latest version of the EMN glossary is always published on the EMN website, the last printed version was published in May 2018, https:// home-affairs.ec.europa.eu/networks/european-migration-network-emn/emn-asylum-and-migration-glossary_en, last accessed on 15 January 2025. European Commission: Communication on a New Pact on Migration and Asylum, COM (2020) 609 final, https://eur-lex.europa.eu/legal-content/ EN/TXT/?uri=CELEX%3A52020DC0609, last accessed on 15 January 2025. According to the ISO standard 25964 a ‘preferred term (descriptor)’ is a term used to represent a concept. When two or more terms representing the same concept in the same language exist, one of them is designated a ‘preferred term’ under which the main entry in the EMN glossary (with definition, source and notes) is listed; the other(s) are listed under the same entry as synonyms and in a separate list of synonyms at the end of the glossary. EMN ASYLUM AND MIGRATION GLOSSARY 10.0 5
the EU’s multilingual interinstitutional terminology database IATE (Interactive Terminology for Europe),4 such as the Council of the EU, the Translation Centre for the Bodies of the EU (CdT) and the Court of Justice of the EU (CJEU). Increasingly, EMN Observer Countries such as Georgia, the Republic of Moldova and Ukraine are involved in the work conducted on the EMN glossary; this cooperation will be further expanded with the new EMN Observer Countries: Montenegro, Armenia and Serbia. The EMN would therefore like to acknowledge the extensive efforts of the GTWG members and its appreciation for the permission given by other 4 6 entities, specifically the EUAA, IOM, UNHCR, ILO, OECD and the United Nations (UN) to the use of terms and definitions that they had developed previously and which are duly referenced in the EMN glossary. Likewise, the EMN would like to thank representatives of the EU’s terminology database ‘IATE’ for their support in updating the EMN glossary. In the subsequent sections, a brief overview of the EMN is given, followed by an outline of the methodology used to develop the EMN glossary and some guidance as to its presentation and usage. IATE (Interactive Terminology for Europe), https://iate.europa.eu/home, last accessed on 15 January 2025. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
The European Migration Network The European Migration Network (EMN) is an EU network of migration and asylum experts who work together to provide up-to-date, objective, reliable and comparable policy-relevant information and knowledge on emerging issues relating to asylum and migration in Europe to meet the information needs of EU institutions and Member States’ authorities and institutions. The EMN also serves to provide the general public with such information. Council Decision 2008/381/EC of 14 May 20085 established a legal base for the European Migration Network, amended by Regulation (EU) No 516/2014 of the European Parliament and of the Council in April 2014.6 The EMN consists of National Contact Points (NCPs) in the EU Member States (except Denmark) and Observer Countries (Norway, Georgia, Republic of Moldova, Ukraine, Montenegro, Armenia, and Serbia, listed in order of accession to the network). It is coordinated by the European Commission (Directorate-General for Migration and Home Affairs), which is assisted by 5 6 7 a Service Provider (ICF). More information on the EMN, including its structure, activities, reports and studies, may be obtained from its website. The need to exchange information on all aspects of migration had already been identified in the initial development of a common EU Asylum and Migration Policy. To improve the exchange of information between and within EU Member States across the wide range of asylum and migration policy developments, information must be comparable between the Member States and EU institutions to the greatest possible extent, and for this a consistent use of terms is required. Thus, one of the main objectives of the EMN as outlined in Article 2(1c) of Council Decision 2008/381/EC is to improve the consistency and comparability of information between Member States.7 The development of a comprehensive glossary that identifies and describes different concepts central to asylum and migration policy in the EU is one of the main activities undertaken by the EMN to achieve this objective. Council Decision (EU) 2008/381/EC of 14 May 2008 establishing a European Migration Network, https://eur-lex.europa.eu/legal-content/EN/ TXT/?uri=CELEX:32008D0381, last accessed on 15 January 2025. Regulation of the European Parliament and of the Council (EU) 516/2014 of 16 April 2014 establishing the Asylum, Migration and Integration Fund, amending Council Decision 2008/381/EC and repealing Decisions No 573/2007/EC and No 575/2007/EC of the European Parliament and of the Council and Council Decision 2007/435/EC, https://eur-lex.europa.eu/legal-content/EN/TXT/?uri=CELEX:32014R0516&from=EN, last accessed on 15 January 2025. Council Decision (EU) 2008/381/EC of 14 May 2008 establishing a European Migration Network, https://eur-lex.europa.eu/legal-content/EN/ TXT/?uri=CELEX:32008D0381, last accessed on 15 January 2025. EMN ASYLUM AND MIGRATION GLOSSARY 10.0 7
Method and approach followed for developing the EMN glossary Scope of the EMN glossary The EMN glossary offers an EU-wide multidisciplinary and multilingual vocabulary of approximately 540 core terms and concepts in the field of asylum and migration. It has a focus on legal concepts deriving from the EU acquis, while at the same time acknowledging different understandings of terms in a more global or national context, or in different disciplines (e.g. demography, sociology, economics). Emphasis is given to terms relating to international protection and refugees, and legal migration, as well as irregular migration and return. In addition, terms that are relevant to asylum and migration, which pertain to fundamental rights, integration, equality and cross border movement, are also included. The glossary includes entries for European and international institutions, organisations and processes which play a key role in the European migration policy, including bodies contributing to the implementation of the Global Approach to Migration and Mobility and the external dimension (e.g. Bali Process, Black Sea Synergy, European Union Emergency Trust Fund for Africa (EUTF for Africa)). Key EU, European and international legislation is also included. However, terms which describe fundamental principles of governance in the EU, including the complex web of powers and checks and balances among EU institutions, as well as fundamental EU treaties (e.g. the uniform interpretation and primacy of Union law, the European Commission with its respective Directorates General) are outside of the scope of the EMN glossary and therefore not included. Throughout the EMN glossary, wherever there is a reference to a phenomenon (e.g. migration), there is always a reference to the corresponding person (e.g. migrant). To limit redundancy for some terms, preference has been given to the term for either a person or the process, depending on which term is more commonly used. For example, ‘highly qualified migrant’ is a term that is more commonly used than ‘highly qualified migration’. There are some terms in the EMN glossary that have been added for the sake of completeness, but which are no longer considered to be in 8 EMN ASYLUM AND MIGRATION GLOSSARY 10.0 current use, e.g. guest worker. In such instances, the rationale is highlighted in the notes. Processes followed for updating the EMN glossary In order to keep the glossary up-to-date and relevant, it is developed and continuously updated by a dedicated EMN Glossary and Thesaurus Working Group (GTWG) consisting of representatives from EMN Member and Observer Countries. As already mentioned in the introduction, the GTWG cooperates with key EU and international actors in the field of migration and asylum. Some of them (such as the EUAA) regularly participate in the GTWG meetings, others on an ad-hoc basis, especially when terms and concepts from their specific field of expertise are discussed (such as FRA in the context of fundamental rights, Frontex in the context of border security and return, EIN in the context of integration). Other organisations (UNHCR, IOM) send written contributions. Another added value of the EMN glossary is that it provides verified national translations of the terms for almost all EU Member States languages (except Danish) plus Norwegian as well as definitions in a number of languages. Since the update to Version 10.0, also Georgian, Ukrainian and Armenian translations are included resulting from the close cooperation with these EMN Observer Countries. This is particularly interesting for translators and interpreters working in the EU as well as in EMN Observer Countries. Against this background the EMN GTWG has extended their collaboration and now also cooperates with EU Council institutions participating in the EU terminology database IATE. The EU harmonised terminology ensures comparability and common understanding of terms and concepts and intends to make communication easier for policymakers, legislators, practitioners, media and people interested in migration. It may contribute to improve EU legislation by a consistent use of terms and definitions when suggesting new legislation.
The EMN glossary reflects – to the greatest extent possible – the most up-to-date developments in the field of asylum and migration, and the understanding of terms and concepts. In this way, the GTWG aims to support policymakers at the cusp of defining new concepts relevant in the field. The EMN glossary is available in different formats: as an interactive online glossary via the EMN central website and national websites which is updated on a regular basis. The EMN glossary is also available to users as a mobile application for download by Android and iOS users, which provides convenient access to terms translated into 27 languages, with browsable definitions in English, Finnish, French, German, Greek, Italian and Latvian. The app provides an alphabetical search, browse functions for the terms, as well as a visual navigation of relationships between terms. From time to time, a printed edition is published following more substantial updates and new terms, the last printed version was published in May 2018 on the occasion of the 10th anniversary of the EMN. Readers are invited to suggest new terms and/or definitions for the EMN glossary, and to comment on existing ones by contacting the EMN. Hierarchy of sources for defining terms As existing definitions in the field of asylum and migration can be vague, controversial or contradictory, and for many terms there are no universally accepted definitions, the Glossary and Thesaurus Working Group (GTWG) draws on a variety of different sources. However, priority is given to definitions from the EU acquis, without neglecting other relevant sources from other contexts. Therefore, the GTWG has established a transparent hierarchy of sources from which definitions should be selected, which is as follows: 1. EU regulations/directives/decisions and then any definitions given in European Commission communications, particularly those with proposals for directives; 2. Other EU entities, including Eurostat, the European Union Agency for Asylum (EUAA), the European Union Agency for Fundamental Rights (FRA), the European Border and Coast Guard Agency (Frontex), the European Integration Network (EIN), the European Union Agency for Criminal Justice Cooperation (Eurojust) and the European Union Agency for Law Enforcement Cooperation (Europol). 3. European/international conventions, treaties and protocols (e.g. on smuggling, trafficking and forced labour from the United Nations, the Council of Europe and the International Criminal Court); 4. Glossaries developed by international bodies, such as the United Nations High Commissioner for Refugees (UNHCR), the International Organization for Migration (IOM), the International Labour Organisation (ILO) and the Organisation for Economic Cooperation and Development (OECD); 5. Other relevant (EU) projects/entities (e.g. the Global Citizenship Observatory (GLOBALCIT): Glossary on Citizenship and Electoral Rights THESIM). 6. Some of the existing definitions of EMN glossary entries have been modified so as to better reflect the usage of the term in the context of asylum and migration policy in the EU; where this is the case, it is indicated in the ‘source’ that the definition is ‘derived by’ the EMN. Likewise, some definitions had to be developed by the working group itself, as they could not be sourced from the references outlined above; in such cases the entry source indicates that the definition was ‘developed by’ the EMN. Definitions Each EMN glossary definition has been formulated according to the IATE standard, meaning that they can directly replace the term in any given text. For example, the term ‘applicant for international EMN ASYLUM AND MIGRATION GLOSSARY 10.0 9
protection’ can be directly replaced in any text with its definition: ‘third-country national or a stateless person who has made an application for international protection in respect of which a final decision has not yet been taken’. Parts of the terms of the EMN glossary have already been integrated into the IATE database. Some terms are understood differently when they are used in a global context, an EU context or specific legal contexts (e.g. in the context of the Schengen Convention or Dublin Regulation). In such cases, the context in which a term should be understood is indicated in the definition. Terms which have a specific linkage to asylum and migration issues but which can be understood in contexts other than asylum and migration (e.g. access to healthcare, school pupil, student, researcher) are defined specifically for the asylum and migration context. Terms that do not have an obvious link to asylum and migration (e.g. child care, civil war, (environmental) disaster, economic 10 sector, education, language) have been omitted from the EMN glossary. As many definitions are derived from the EU acquis, they are, in most cases, valid for all EU and often for all EFTA Member States. Where national definitions deviate from that of the EMN glossary, this is indicated in the notes. Preferred terms and synonyms Where multiple interchangeable terms (synonyms) were available for a single concept, a ‘preferred term’ was selected and all the other possible terms (including quasi-synonyms, acronyms and abbreviations) were listed as synonyms. In some cases, the synonym is more common in an EU Member State than the ‘preferred term’ – e.g. ‘deportation’ is more commonly used than ‘removal’ in many EU Member States, even though ‘removal’ is the term used in EU legislation. In such cases, an explanatory note has been added to clarify national specificities. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
Format of the EMN glossary The development of the EMN glossary also included agreeing on a common approach with regard to the formatting of the terms and definitions, as outlined in this section. EMN Observer Countries’ languages following the languages codes of the ISO standard 639-19 (see section 4.5). It should be noted that the ISO codes for languages often differ from those of the countries in which they are spoken, i.e. Sweden is ‘SE’ whereas Swedish is ‘sv’, but both France and French are abbreviated to ‘FR’. The ISO language code for Georgian is ka, for Ukrainian is uk and that for Armenian is hy. Order of terms The preferred terms are listed in (English) alphabetical order. Where the term is an expression or compound word (i.e. comprised of more than one word), the entry reflects the ordering of the term in common usage – e.g. economic migration or applicant for international protection. Source of information of notes Unless indicated to the contrary, all text appearing in the note has the same source as the definition. Nominal agreement and gender neutrality in the EMN glossary Translations Terms are listed in the singular (not plural). Only in exceptional cases, when a term is commonly used in the plural form, such as e.g. “durable solutions” or “fundamental rights”, is it listed in plural form. To the greatest extent possible, both the terms and their definitions are gender neutral. For consistency with the IATE database, the genderneutral plural pronouns ‘they’, ‘them’, ‘their’ have been used throughout, even when referring to the singular. While some EU languages employ a gender system of agreement for nouns (e.g. in German, Migrant for a male migrant and Migrantin for a female migrant), for simplicity and for consistency with other glossaries only one gender form of such terms (the most generic) is used for these entries. Use of ISO standards for listing EU Member States and EU languages All references to EU and EFTA Member States - whether in the definition, notes or sub-heading - use abbreviations according to the country codes of the ISO standard 3166-1 alpha 2.8 All other countries are mentioned in full. However, the translations of the terms are listed in accordance with the abbreviations of EU Member States’ and 8 9 Whilst the EMN glossary has been developed in English by the multilingual members of the working group, another aspect that was mentioned previously, was the need for translations. One feature of the EMN glossary is to have translations of the terms into all EU Member State languages (except Danish) plus Norwegian, Georgian, Ukrainian and Armenian. The languages of the EMN Observer Countries are listed in the order in which they joined the EMN. The translations are, to the greatest possible extent, direct translations of the English term, or otherwise a translation that better reflects the concept/definition given. For some terms, no translation was available, either because the English term has been borrowed into the language and is more commonly used, or because the term is not used in a national context. In the case of the former (English term preferred), this is indicated under the field for the translation as ‘no usual translation’. In the latter case (where the term is not used at all in a national context), this is indicated by ‘no translation’. Conversely, some terms have more than one translation available in the national context, depending on whether reference was being made to national law or the EU acquis. In these cases, more translations have been provided, starting with the context of the EU acquis and followed by ISO 3166-1, alpha-2 country code list, https://www.iso.org/iso-3166-country-codes.html, last accessed on 15 January 2025. ISO 639-1 language codes, Localizely, https://localizely.com/iso-639-1-list/ last accessed on 15 January 2025. EMN ASYLUM AND MIGRATION GLOSSARY 10.0 11
the national context, separated by a semicolon. The European context is indicated by ‘(EU acquis)’ and the national translation is added without any further remark. The Slovak translation of ‘breeder documents’ may serve as an example: východiskové doklady (EU acquis); zdrojové doklady. In cases where there are no such indications, but more than one translation is given (separated by a ‘/’), the translations can be used synonymously. The acronyms used in the EMN glossary for the translations refer to the EU Member State languages. As mentioned previously, they follow the languages codes of the ISO standard 639.10 EU Member States having the same nominal language (e.g. AT/DE/LU, BE/FR/LU or BE/NL) are grouped together under the language ‘DE’, ‘FR’ and ‘NL’ and any national deviations from the translation provided are indicated between parentheses11 – e.g. the term asylum seeker is translated as Asylwerber in Austria (AT), Asylbewerber in Germany (DE) and in the context of the EU acquis, and in Luxembourg (LU), Asylantragsteller. A semicolon is used to separate synonyms of the translation in the same nominal language. The entry of the German translation of the term asylum seeker thus looks as follows: Asylbewerber (EU acquis, DE); Asylwerber (AT); Asylantragsteller (LU). Relationships between terms Most of the entries listed in the EMN glossary list a number of terms related to the preferred term through an equivalence, hierarchical or associative relationship: „ An equivalence relationship is a relationship between two terms that represent the same concept and which are therefore (virtually) interchangeable. In the EMN glossary, synonyms have an equivalence relationship and are understood to also include terms that may represent a slightly different concept (i.e. quasi-synonyms), as well as acronyms and abbreviations. All synonyms are listed in a separate list at the end of the glossary. „ A hierarchical relationship is a relationship between a pair of concepts in which one falls within the scope of the other – see broader term and narrower term. A broader term indicates the relationship between a more generic and a more specific term. For example, ‘economic migrant’ is a broader term of the term ‘labour migrant’, which in turn is the narrower term. „ An associative relationship is a relationship between a pair of concepts that are not related hierarchically but which share a strong semantic or conceptual connection. Such related terms are not related in a hierarchical manner but have an association, which may help users to understand wider contexts and meanings of the terms in which they have an interest. References to other terms in the EMN glossary Where a preferred term existing and defined elsewhere in the EMN glossary is used in a particular definition or a note or by an indicated (hierarchical or associative) relationship (see section 4.6 above), then this term is indicated in bold the first time it is used in the definition and in the notes. For example, the definition for the term ‘long-term resident’ is given as ‘A third-country national who has long-term resident status as provided for under Articles 4 to 7 of Council Directive 2003/109/EC (Long Term Residents Directive) or as provided for under national legislation’; ‘third-country national’ is in bold as it is defined elsewhere in the EMN glossary. References to other sources Where in a definition or note, a source of an information (legal norms such as EU directives, international treaties, webpages, publications) is mentioned, a hyperlink is directly referring to the respective source. 10 Ibid. 11 Note that when the Norwegian terms differ in the two official versions of written Norwegian, the two terms have been given in the following format ‘...(b) ; …(n)’. 12 EMN ASYLUM AND MIGRATION GLOSSARY 10.0
Glossary EMN ASYLUM AND MIGRATION GLOSSARY 10.0 13
absconding BG укриване CS útěk DE Untertauchen EL διαφυγή EN absconding ES fuga ET kõrvalehoidumine FI pakeneminen FR fuite GA éalú s.; éalaitheach a. HR bježanje HU engedély nélküli eltávozás / ismeretlen helyre távozás IT fuga LT pasislėpimas LV bēgšana MT Ħarba NL onderduiken PL ucieczka PT fuga / evasão RO sustragere SK útek SL pobeg SV avvikande NO unndragelse (b); unndraging (n) KA მიმალვა UK втеча HY 14 արդարադատությունից խուսափել EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Definition(s) Action by which a person seeks to avoid administrative measures and/or legal proceedings by not remaining available to the relevant authorities or to the court. Source(s) Derived by EMN from the definition of ‘risk of absconding’ in Art. 3(7) of Directive 2008/115/EC (Return Directive). Narrower term(s) risk of absconding EMN Asylum and Migration Classification 6.3 Specific aspects of migration procedures| 13. Irregular Migration Euro Voc Classification 2811 migration
accelerated international protection procedure BG ускорено производство за предоставяне на международна закрила A B C D Definition(s) EL ταχεία διαδικασία εξέτασης αιτήσεως διεθνούς προστασίας An expedited procedure to examine an application for international protection which is either already deemed manifestly unfounded, which involves serious national security or public order concerns, or which is a subsequent application. EN accelerated international protection procedure Source(s) CS zrychlené řízení o mezinárodní ochraně DE beschleunigtes Verfahren auf internationalen Schutz E F G ET kiirendatud rahvusvahelise kaitse menetlus Derived by EMN from the Council of Europe’s Guidelines on human rights protection in the context of accelerated asylum procedures 2009 FI kansainvälistä suojelua koskeva nopeutettu menettely Synonym(s) ES tramitación de urgencia FR procédure accélérée de traitement d’une demande de protection internationale GA Nós Imeachta Luathaithe um Chosaint Idirnáisiúnta HR ubrzani postupak međunarodne zaštite HU gyorsított menekültügyi eljárás IT procedura accelerata di esame della domanda di protezione internazionale LT paspartinta tarptautinės apsaugos procedūra (EU acquis); paspartinta prieglobsčio procedūra LV paātrināta starptautiskās aizsardzības piešķiršanas procedūra MT Proċedura aċċellerata għall-protezzjoni internazzjonali NL versnelde procedure voor de behandeling van het verzoek om internationale bescherming PL procedura przyspieszona w sprawie o udzielenie ochrony międzynarodowej PT processo acelerado de proteção internacional RO procedură accelerată de examinare a cererii de protecție internațională SK zrýchlený postup posudzovania žiadosti o medzinárodnú ochranu SL pospešeni postopek obravnavanja prošnje za mednarodno zaščito SV påskyndat prövningsförfarande av ansökan om internationellt skydd accelerated procedure for international protection speedy asylum procedure speedy international protection procedure I J K Broader term(s) procedure for international protection L EMN Asylum and Migration Classification 6.2.3 First Instance (Administrative) determination procedure M Euro Voc Classification 1011 European Union law| 2811 migration N Note(s) O 1. As per the Committee of Ministers of the Council of Europe’s guidelines on human rights protection in the context of accelerated asylum procedures of 1 July 2009, the procedure derogates from normally applicable procedural timescales and / or procedural guarantees with a view to expediting decision-making. Procedures whereby a state may declare an application inadmissible without considering the merits of the claim also fall mutatis mutandis within the scope of the guidelines. For more information see the webpage of the Council of Europe. 2. Directive 2013/32/EU (Recast Asylum Procedures Directive) recognises, in Recital 18 of the Preamble and in Art. 31(2) that it is in the interest of both EU Member States and applicants for international protection for decisions to be taken as soon as possible. This Directive does not provide for minimum or maximum time limits for taking a decision on applications for international protection nor does it define the term ‹accelerated procedure›. However, Art. 31(2) does make clear that the speed of the asylum procedure may not prejudice ‹an adequate and complete examination› of the asylum claim. 3. Accelerated procedures must comply with the basic principles and guarantees laid down in Chapter II of Directive 2013/32/EU (Recast Asylum Procedures Directive) and may be conducted only in limited cases laid down in Art. 31(8) of the Directive. NO hurtigprosedyre for behandling av asylsøknader (b); hurtigprosedyre for handsaming av asylsøknader (n) P Q R S T U V W KA საერთაშორისო დაცვის დაჩქარებული პროცედურა X UK прискорена процедура надання міжнародного захисту HY H Y միջազգային պաշտպանության դիմումի արագընթաց քննություն Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 15
access to education BG достъп до образование CS přístup ke vzdělání DE Zugang zu Bildung EL πρόσβαση στην εκπαίδευση EN access to education ES ET juurdepääs haridusele FI oikeus koulutukseen FR accès à l’éducation Definition(s) a) In the general migration context, requirements for and scope of admission to the education system to migrants and refugees in a host country. b) In the EU migration context, requirements for and scope of access to the education system for thirdcountry nationals (such as legally resident migrants, beneficiaries of and applicants for international protection) in EU Member States. Source(s) IT accesso all’istruzione a) Developed by EMN b) Derived by EMN from Art. 11(1b) of Council Directive 2003/109/EC (Long Term Residents Directive), and Art. 27 of Directive 2011/95/EU (Recast Qualification Directive) LT galimybė mokytis Broader term(s) GA rochtain ar oideachas HR pristup obrazovanju HU oktatáshoz való hozzáférés LV izglītības pieejamība MT Aċċess għall-edukazzjoni NL toegang tot onderwijs PL dostęp do edukacji PT acesso à educação RO acces la educație SK prístup k vzdelávaniu SL dostop do izobraževanja SV tillträde till utbildning NO tilgang til utdanning KA განათლების ხელმისაწვდომობა UK Доступ до освіти HY 16 կրթության հասանելիություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0 content of international protection third-country national legal migration Related term(s) access to employment access to healthcare access to procedures for recognition of qualifications access to social welfare EMN Asylum and Migration Classification 8.3 Access to education Euro Voc Classification 2811 migration| 3206 education
A B C D Note(s) E 1. Art. 17 and 18 of the Geneva Refugee Convention and Protocol accord refugees lawfully staying in a host country the right to work and to engage in wage earning employment or self-employment. However, the Convention does not explicitly grant the right to work to asylum-seekers. It also does not prohibit the use of employment restrictions (to specific sectors, or regarding the duration of the work, or the priority for specific categories of persons). 2. In EU Member States, the scope of access to education and vocational training of third-country nationals depends on their residence or employment status. 3. Art. 11(1b) of Council Directive 2003/109/EC (Long Term Residents Directive) ensures that long-term resident third-county nationals enjoy equal treatment with nationals as regards access to education. Pursuant to Art. 11(3b) EU Member States may require proof of appropriate language proficiency for access to education and training. Access to university may be subject to the fulfilment of specific educational prerequisites. 4. Art. 27 of Directive 2011/95/EU (Recast Qualification Directive) states that minors granted international protection have full access to the education system under the same conditions as nationals. It also allows adults granted international protection access to the general education system, further training or retraining, under the same conditions as third-country nationals legally resident. 5. Art. 14 of Directive 2013/33/EU (Recast Reception Conditions Directive) provides for minor applicants for international protection access to the education system under similar conditions as nationals for so long as an removal order is not enforced. Such education may be provided in accommodation centres. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 17
access to employment BG достъп до заетост CS přístup k zaměstnání DE Zugang zu Beschäftigung / Zulassung zu einer Beschäftigung / Zugang zum Arbeitsmarkt / Zulassung zum Arbeitsmarkt EL πρόσβαση στην εργασία EN access to employment ES acceso al empleo / acceso al mercado laboral ET juurdepääs tööturule FI oikeus työhön FR accès à l’emploi GA rochtain ar fhostaíocht HR pristup zapošljavanju HU munkavállaláshoz való hozzáférés IT accesso all’occupazione LT galimybė įsidarbinti LV nodarbinātības iespējas MT Aċċess għall-impieg NL Toegang tot werk PL dostęp do zatrudnienia/ dostęp do rynku pracy PT acesso ao emprego RO acces la muncă / acces la piața muncii SK prístup k zamestnaniu SL dostop do zaposlitve SV tillträde till arbetsmarknaden NO tilgang til arbeidsmarkedet (b); tilgang til arbeidsmarknaden (n) KA დასაქმების ხელმისაწვდომობა UK доступ до працевлаштування HY 18 աշխատանքի հասանելիություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Definition(s) In the general migration context, conditions and requirements governing admittance to the labour market for migrants and refugees legally residing in a host country. In the EU migration context, authorization of thirdcountry nationals (legally resident migrants, beneficiaries of and applicants for international protection) to engage in employed or self-employed activities in EU Member States subject to the rules generally applicable to the profession and public service, as well as employment and working conditions. Source(s) General migration context: Derived by EMN from Art. 17 and 18 of the Geneva Refugee Convention and Protocol EU migration context: Derived by EMN from Art.11(1a) of Council Directive 2003/109/EC (Long Term Residents Directive) and Art. 26 of Directive 2011/95/EU (Recast Qualification Directive) Synonym(s) access to the labour market Broader term(s) content of international protection Related term(s) access to education access to healthcare access to procedures for recognition of qualifications access to social welfare EMN Asylum and Migration Classification 8.2 Access to employment Euro Voc Classification 2811 migration| 4406 employment
A B C D Note(s) E 1. Art. 17 and 18 of the Geneva Refugee Convention and Protocol accord refugees lawfully staying in a host country the right to work and to engage in wage earning employment or self-employment. However, the Convention does not explicitly grant the right to work to asylum-seekers. It also does not prohibit the use of employment restrictions (to specific sectors, or regarding the duration of the work, or the priority for specific categories of persons. 2. In EU Member States the right to enter the labour market depends on the migrant’s legal status. 3. Art. 11 (1a) of Council Directive 2003/109/EC (Long Term Residents Directive) ensures that long-term resident third-country nationals enjoy equal treatment with nationals as regards access to employment and self-employed activity. Pursuant to Art. 11(3a) EU Member States may retain restrictions to access to employment or self-employed activities in cases where, in accordance with existing national or Community legislation, these activities are reserved to nationals, EU or EEA citizens. 4. Art. 26 of Directive 2011/95/EU (Recast Qualification Directive) ensures that beneficiaries of international protection have access to the labour market under equivalent conditions as nationals, immediately after protection has been granted as well as access to employment-related education opportunities for adults, vocational training, including training courses for upgrading skills, practical workplace experience and counselling services afforded by employment offices. 5. Art. 15 of Directive 2013/33/EU (Recast Reception Conditions Directive) provides that applicants for international protection have access to the labour market no later than 9 months from the date when the application for international protection was lodged, if a first instance decision by the competent authority has not been taken and the delay cannot be attributed to the applicant. EU Member States can decide the conditions for granting access to the labour market in accordance with their national law. For reasons of labour market policies, they may give priority to Union citizens, EEA nationals and to legally resident third-country nationals . F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 19
access to healthcare BG достъп до здравни гриижи CS přístup ke zdravotní péči Definition(s) EL πρόσβαση σε υγειονομική περίθαλψη (EL) ; πρόσβαση σε ιατροφαρμακευτική περίθαλψη (CY) Healthcare entitlements enjoyed by third-country nationals (migrants, applicants for international protection and refugees) in EU Member States and in their countries of origin. EN access to healthcare Source(s) DE Zugang zu medizinischer Versorgung FI oikeus terveydenhuoltoon Derived by EMN from Art. 11 of Council Directive 2003/109/EC (Long Term Residents Directive) and Art. 30 of Directive 2011/95/EU (Recast Qualification Directive) FR accès aux soins de santé Synonym(s) ES acceso a la asistencia sanitaria ET juurdepääs tervishoiule GA Rochtain ar Chúram Sláinte HR pristup zdravstvenoj zaštiti healthcare benefits medical benefits HU egészségügyi ellátáshoz való hozzáférés Broader term(s) IT accesso all’assistenza sanitaria social protection benefits LT sveikatos priežiūros paslaugų prieinamumas EMN Asylum and Migration Classification LV veselības aprūpes pieejamība 8.5 Access to health care MT Aċċess għas-servizzi tas-saħħa / għall-kura sanitarja Euro Voc Classification NL toegang tot gezondheidszorg PL dostęp do opieki zdrowotnej PT acesso aos cuidados de saúde RO acces la ingrijirea sanatatii / acces la sistemul medical SK prístup k zdravotnej starostlivosti SL dostop do zdravstvenega varstva SV tillgång till hälso- och sjukvård NO tilgang til helsetjenester (b); tilgang til helsetenester (n) KA ჯანდაცვის ხელმისაწვდომობა UK доступ до медичної допомоги HY 20 առողջապահական խնամքի հասանելիություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0 2811 migration| 2841 health Note(s) 1. In EU Member States, the scope of healthcare to which a third-country national has access depends on their residence or employment status. For further information see EMN: Migrants access to social security and healthcare: policies and practice, 2014. 2. According to Council Directive 2003/109/EC (Long Term Residents Directive), long-term residents enjoy the same access to healthcare as nationals as defined by national law. 3. Directive 2011/95/EU (Recast Qualification Directive) grants access to adequate healthcare, including treatment of mental disorders when needed, to beneficiaries of international protection under the same eligibility conditions as nationals of the EU Member State that has granted such protection. 4. Directive 2013/33/EU (Recast Reception Conditions Directive) establishes minimum standards for access to healthcare for applicants of international protection during the asylum procedure. It requires EU Member States to ensure that asylum seekers at least receive emergency care and essential treatment for illnesses and serious mental disorders. However, the entitlement of asylum seekers to healthcare services depends on national legislation and varies among Member States. See for example, the EMN: Ad-Hoc Query on System of medical treatment of asylum seekers in Member States. 5. Access to healthcare can be a key factor in the process of decision-making on applications for international protection. Subsidiary protection may apply if the asylum-seeker contends that a return to the country of origin is impossible for health reasons, as the return of a sick person which is often connected with the medical standards in the country of return could constitute a breach of Art. 3 ECHR. Thus case workers have to take into account whether medical treatment is available in the country of origin and whether the available medical treatment would also be (e.g. financially) accessible to the concerned person upon return. For further information see the description of the MedCOI project in the List of projects funded by the European Refugee Fund in 2011.
access to procedures for recognition of qualifications BG достъп до процедури за признаване на квалификации A B C D Definition(s) CS přístup k řízením o uznávání kvalifikací DE Zugang zu Verfahren für die Anerkennung von Befähigungsnachweisen (EU acquis); Zugang zu Verfahren für die Anerkennung von Qualifikationen EL πρόσβαση στις διαδικασίες για αναγνώριση προσόντων EN access to procedures for recognition of qualifications ES ET juurdepääs kvalifikatsioonide tunnustamise menetlusele FI oikeus ulkomailla suoritettujen tutkintojen kelpoisuuden tunnustamiseen FR accès aux procédures de reconnaissances des qualifications a) In the global migration context, conditions and requirements governing the admission to procedures for recognition of professional diplomas, certificates and other evidence of formal qualifications for migrants and refugees in host countries in accordance with relevant national procedures. b) In the EU migration context, conditions and requirements governing the admission to procedures for recognition of professional diplomas, certificates and other evidence of formal qualifications for third-country nationals (legally resident third-country nationals, beneficiaries of international protection) in EU Member States in accordance with the relevant national procedures. E Source(s) K a) global migration context: Developed by EMN b) EU migration context: Derived by EMN from Art. 11(1c) of Council Directive 2003/109/EC (Long Term Residents Directive) and Art. 28 of Directive 2011/95/EU Recast Qualification Directive. GA rochtain ar nósanna imeachta um cháilíochtaí a aithint HR pristup postupcima za priznavanje kvalifikacija HU A képesítések elismertetésére alkalmazott eljárásokhoz történő hozzáférés content of international protection legal migration LT galimybė naudotis kvalifikacijų pripažinimo tvarka G H I J L M N Broader term(s) IT Accesso alle procedure di riconoscimento delle qualifiche F O Related term(s) access to education access to employment access to healthcare access to social welfare P PL dostęp do procedur uznawania kwalifikacji EMN Asylum and Migration Classification R PT acesso aos procedimentos de reconhecimento de qualificações Euro Voc Classification S LV kvalifikāciju atzīšanas procedūru pieejamība MT Aċċess għall-proċeduri fir-rikonoxximent tal-kwalifiki NL toegang tot procedures voor de erkenning van kwalificaties 8.6 Other rights 2811 migration| 3206 education RO acces la procedurile de recunoaștere a calificărilor SK prístup k postupom uznávania kvalifikácií SL dostop do postopka priznavanja poklicnih kvalifikacij NO tilgang til ordninger for godkjenning av kvalifikasjoner (b); tilgang til ordningar for godkjenning av kvalifikasjonar (n) ხელმისაწვდომობა UK доступ до процедур визнання кваліфікацій HY որակավորումների ճանաչման ընթացակարգերի հասանելիություն T Note(s) SV tillgång till förfaranden för erkännande av kvalifikationer KA კვალიფიკაციების აღიარების პროცედურების Q 1. Art. VII of the LisbonRecognition Convention (LRC) requires States to take reasonable steps and develop feasible procedures within the framework of their education system and in conformity with their constitutional, legal, and regulatory provisions to determine whether refugees, displaced persons and persons in a refugee-like situation fulfil the relevant requirements for access to higher education, to further higher education programmes or to employment activities, even in cases in which the qualifications obtained in one of the Parties cannot be proven through documentary evidence. 2. Under EU legislation certain third-country nationals enjoy equal treatment with nationals as regards recognition of professional diplomas, certificates and other qualifications, in accordance with the relevant national procedures: ƒ family members of EU citizens according to Art. 24 of Council Directive 2004/38/EC (Free Movement Directive), ƒ long term residents according to Art. 11(1c) of Council Directive 2003/109/EC (Long Term Residents Directive), ƒ beneficiaries of international protection according to Art. 28 (1) of Directive 2011/95/EU (Recast Qualification Directive), ƒ EU Blue Card holders according to Art. 14(d) of Directive 2009/50/EC (Blue Card Directive) as well as ƒ students, researchers and school pupils according to Art. 22(4) of Directive 2016/801/EU (Recast Students’ Directive). EMN ASYLUM AND MIGRATION GLOSSARY 10.0 21 U V W X Y Z
access to social welfare BG достъп до социални грижи CS přístup k sociálnímu zabezpečení DE Zugang zur Sozialhilfe / Zugang zu Sozialleistungen EL πρόσβαση σε κοινωνική πρόνοια EN access to social welfare ES acceso a protección social ET juurdepääs sotsiaalhoolekandele FI oikeus sosiaalihuoltoon FR accès à l’aide sociale GA rochtain ar leas sóisialta HR pristup socijalnoj skrbi HU szociális ellátáshoz való hozzáférés IT accesso al welfare LT galimybė naudotis socialinės gerovės sistema LV sociālās labklājības pieejamība MT NL toegang tot sociale voorzieningen (BE) / toegang tot het sociale zekerheidsstelsel (NL) PL dostęp do opieki społecznej PT Acesso à proteção social RO acces la asistența socială SK prístup k sociálnemu zabezpečeniu SL dostop do socialne zaščite SV tillgång till sociala förmåner NO tilgang til sosiale velferdstjenester KA სოციალური დაცვის ხელმისაწვდომობა UK доступ до соціального забезпечення HY սոցիալական ապահովության հասանելիություն Definition(s) a) In the general migration context, conditions and requirements governing access to social protection and the scope of social security and social assistance for migrants and refugees legally residing in a host country. b) In the EU migration context, conditions and requirements governing access to social protection and the scope of social security and social assistance for third-country nationals (legally residing migrants, beneficiaries of international protection, persons enjoying temporary protection and applicants for international protection) in EU Member States as defined by national law. Source(s) a) Derived by EMN from Art. 11(d) of Council Directive 2003/109/EC (Long Term Residents Directive) b) Derived by EMN from Art. 11(d) of Council Directive 2003/109/EC (Long Term Residents Directive) and Art.29 of Directive 2011/95/EU (Recast Qualification Directive) Broader term(s) content of international protection Narrower term(s) social security Related term(s) access to education access to employment access to healthcare access to procedures for recognition of qualifications EMN Asylum and Migration Classification 8.4 Access to social welfare Euro Voc Classification 2811 migration| 2836 social protection 22 EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. The terms social protection, social security and social assistance are not defined by EU law and are often understood similarly. However, social protection is generally considered as an overarching concept encompassing ‘all public and private initiatives that provide income or consumption transfers to the poor, protect the vulnerable against livelihood risks, and enhance the social status and rights of the marginalised with the overall objective of reducing the economic and social vulnerability of poor, vulnerable and marginalised groups’, see IATE entry of social protection. 2. Social security and social assistances are narrower concepts. IATE defines social security as a ‘system of pensions and benefits provided through the welfare system, designed to give some kind of security against exigencies such as unemployment, invalidity, and old age’, see IATE entry of social security . Social assistance is defined in IATE as ‘range of benefits and services provided to the population at large, or segments of the population, under schemes funded by general government which are commonly based on a test of resources and do not require direct contributions by, or on behalf of, potential beneficiaries.It should not be confused with social security or social insurance which are based on contributions, see IATE entry of social assistance. 3. The Geneva Refugee Convention and Protocol ensures that recognised refugees are entitled to benefit from the national social welfare schemes enjoyed by nationals. Refugees are gradually awarded access to social security benefits, taking into account the duration of their residence and their integration into the host society. 4. In the EU the level of social benefits and rights depends on the legal status of third-country nationals. 5. Art.11(1d) of Council Directive 2003/109/EC (Long Term Resident Directive) and Art. 29 of Directive 2011/95/EU (Recast Qualification Directive) guarantee that long-term residents and beneficiaries of international protection enjoy equal treatment with nationals as regards social protection, social security and social assistance as defined by national law. EU Member States may limit social assistance granted to beneficiaries of subsidiary protection status to core benefits which will then be provided at the same level and under the same eligibility conditions as nationals. 6. For more information see: EMN Inform: Social benefits and rights for beneficiaries of international protection, 2018. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 23
access to the procedure for international protection BG достъп до производство за международна закрила CS přístup k řízení ve věci mezinárodní ochrany DE Zugang zum Verfahren auf internationalen Schutz EL Πρόσβαση στη διαδικασία διεθνούς προστασίας EN access to the procedure for international protection ES acceso al procedimiento de protección internacional ET juurdepääs rahvusvahelise kaitse menetlusele FI pääsy kansainvälistä suojelua koskevaan menettelyyn Definition(s) The obligation of EU Member States to ensure that a person who has made an application for international protection has an effective opportunity to lodge it as soon as possible. Source(s) Art. 6(2) of Directive 2013/32/EU (Recast Asylum Procedures Directive) Narrower term(s) lodging an application for international protection FR accès à la procédure d’octroi de la protection internationale Related term(s) GA rochtain ar nós imeachta cuí EMN Asylum and Migration Classification making an application for international protection HR pristup postupku međunarodne zaštite 6.2.1 Access to the international protection procedure HU menekültügyi eljáráshoz való hozzáférés Euro Voc Classification IT accesso alla procedura di registrazione della domanda di protezione internazionale 1011 European Union law| 2811 migration LT galimybė naudotis tarptautinės apsaugos procedūra (EU acquis); galimybė pasinaudoti prieglobsčio suteikimo procedūra Note(s) LV piekļuve starptautiskās aizsardzības procedūrai MT Aċċess għall-proċedura f’talbiet għall-protezzjoni internazzjonali NL toegang tot de procedure PL dostęp do procedury PT acesso ao procedimento de proteção internacional RO acces la procedura de examinare a cererii de azil SK prístup ku konaniu o medzinárodnej ochrane SL dostop do postopka mednarodne zaščite SV rätt till prövning av ansökan om internationellt skydd NO tilgang til søknadsprosedyren for internasjonal beskyttelse (b); tilgang til søknadsprosedyren for internasjonalt vern (n) KA საერთაშორისო დაცვის პროცედურის ხელმისაწვდომობა UK доступ до процедури міжнародного захисту HY 24 միջազգային պաշտպանության գործընթացին հասանելիություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0 1. The word “effective” is key in this definition and encompasses that applicants are ensured the possibility to cooperate and communicate with the competent authorities in a proper and adequate manner. 2. Applicants should be able to present the relevant facts of their case and ensured sufficient procedural guarantees in all stages of the procedure.
A B accommodation centre BG център за настаняване CS pobytové středisko C D Definition(s) DE Unterbringungszentrum A place used for the collective housing of applicants for international protection. E EL κέντρο φιλοξενίας Source(s) F EN accommodation centre ES centro de acogida ET majutuskeskus FI vastaanottokeskus (EN accommodation centre) FR centre d’hébergement GA lárionad cóiríochta /gu & ai: lárionaid chóiríochta) HR prihvatilište HU befogadó állomás IT centro di accoglienza LT apgyvendinimo centras Art. 2(i) of Directive 2013/33/EU (Recast Reception Conditions Directive) G Broader term(s) H reception facilities Related term(s) I reception centre EMN Asylum and Migration Classification 4.4 Reception and Accommodation of Applicants for international protection and other refugees J Euro Voc Classification K 2811 migration L LV izmitināšanas centrs MT Ċentru ta’ akkomodazzjoni NL asielzoekerscentrum (NL); opvangcentrum (BE) PL ośrodek dla osób ubiegających się o status uchodźcy PT centro de acolhimento RO centru de cazare Note(s) 1. Such places include decentralised accommodation centres. 2. In FI, the preferred English translation is ‘reception centre’. 3. For more information on categories of reception facilities available in EU Member States, see EMN: The Organisation of Reception Facilities for Asylum Seekers in different Member States, 2014. N O SK ubytovacie zariadenie (EU acquis); pobytový tábor SL nastanitveni center P SV förläggning NO asylmottak / mottakssenter Q KA განთავსების ცენტრი R UK центр розміщення HY M կացարանով ապահովման կենտրոն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 25
accompanied child BG придружено дете CS nezletilý s doprovodem Definition(s) ES niño acompañado A child who arrives on the territory of the EU Member States accompanied by their parent/s or an adult responsible for them whether by law or by the practice of the EU Member State concerned, and for as long as they are effectively taken into the care of such a person. ET saatjaga laps Source(s) DE begleitetes Kind EL συνοδευόμενο παιδί EN accompanied child HR dijete s pratnjom Derived by the EMN from Art. 2(l) of Directive 2011/95/ EU (Recast Qualification Directive) and European Asylum Support Office (EASO): EASO Report on asylum procedures for children -EASO practical guide series, 2019 HU kísérővel érkező kiskorú Synonym(s) FI huoltajan kanssa oleva lapsi FR enfant accompagné GA leanbh faoi thionlacan IT bambino accompagnato LT lydimas nepilnametis LV pavadīts bērns MT Tifel/tifla akkumpanjat/a // wild akkumpanjat NL begeleid kind PL dziecko pod opieką PT criança acompanhada RO copil însoțit SK dieťa so sprievodom (EU acquis); sprevádzané dieťa SL otrok s spremstvom SV medföljande barn / barn med medföljande vuxen NO medfølgende barn KA თანმხლებ პირთან ერთად მყოფი ბავშვი UK дитина в супроводі HY 26 EMN ASYLUM AND MIGRATION GLOSSARY 10.0 accompanied minor Broader term(s) child Related term(s) best interests of the child (BIC) minor separated child unaccompanied minor EMN Asylum and Migration Classification 7.2 Minors and unaccompanied minors Euro Voc Classification 2806 family| 2811 migration Note(s) 1.The term ‘accompanied child’ is not explicitly defined in the Union acquis. However, EU legislation defines the term ‘unaccompanied minor’ in Art.2 (I) of Directive 2011/95 EU (Recast Qualification Directive). 2. The terms child and minor are used interchangeably. However, the term minor is normally used only in a legal context when referring to a person who has not reached the age of majority as defined in national legislation. 3. The term and definition of ‘accompanied child’ was developed by the European Union Agency for Asylum (EUAA) a contrario of the term ‹unaccompanied minor› based on the Union asylum acquis. The EMN decided to follow this approach as this term focuses on the relationship. 4. For further information see: EMN: Inform Accompanied children’s right to be heard in international protection procedures, April 2023.
A B acculturation BG акултурация CS akulturace C D Definition(s) ES aculturación A series of changes in cultural mores (ideas, words, values, norms, behaviour, institutions) resulting from direct and continuous contact and interaction between groups of different cultures, particularly through migratory movements or economic exchange, the media and other channels. ET kultuuriline kohanemine Source(s) DE Akkulturation EL επιπολιτισμός, πολιτιστική αλληπεπίδραση EN acculturation FI akkulturaatio Developed by EMN FR acculturation Synonym(s) GA athchultúrú inculturation HR akulturacija Narrower term(s) HU akkulturáció IT acculturazione LT akultūracija LV akulturācija MT Akkulturazzjoni NL acculturatie F G H I J assimilation integration K EMN Asylum and Migration Classification 9. Integration L Euro Voc Classification 2811 migration M PL akulturacja N PT aculturação RO aculturalizare O SK akulturácia SL akulturacija P SV ackulturation NO assimilasjon Q KA აკულტურაცია R UK акультурація HY E ակկուլտուրացիա (համամշակութավորում) S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 27
acquisition of citizenship BG придобиване на гражданство CS nabytí státního občanství Definition(s) DE Erwerb der Staatsangehörigkeit / Erwerb der Staatsbürgerschaft Any mode of becoming a national, i.e. by birth or at any time after birth, automatic or non-automatic, based on attribution, declaration, option or application. EL κτήση ιθαγένειας (EL); απόκτηση ιθαγένειας (CY) Source(s) EN acquisition of citizenship ES adquisición y atribución de nacionalidad ET kodakondsuse omandamine / kodakondsuse saamine FI kansalaisuuden saaminen FR acquisition de la nationalité GA saoránacht a fháil HR stjecanje državljanstva HU állampolgárság megszerzése IT acquisizione di cittadinanza LT pilietybės įgijimas LV pilsonības iegūšana MT Ksib ta’ ċittadinanza NL verkrijging van het staatsburgerschap PL nabywanie obywatelstwa PT aquisição de nacionalidade RO obtinerea cetateniei / dobandirea cetateniei SK nadobudnutie štátneho občianstva / získanie štátneho občianstva SL pridobitev državljanstva SV förvärv av medborgarskap NO erverv av statsborgerskap (b); erverv av statsborgarskap (n) KA მოქალაქეობის მოპოვება UK набуття громадянства HY 28 քաղաքացիության ձեռք բերում EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Global Citizenship Observatory (GLOBALCIT): Glossary on Citizenship and Electoral Rights Broader term(s) citizenship Narrower term(s) naturalisation Related term(s) ius sanguinis ius soli EMN Asylum and Migration Classification 10. Citizenship, Naturalization and Statelessness Euro Voc Classification 2811 migration Note(s) 1. Art. 3(d) of Regulation (EC) No. 862/2007 (Migration Statistics Regulation) refers or relates to the acquisition of citizenship to those persons having their usual residence in the territory of the EU Member State and having acquired during the reference year the citizenship of the EU Member State and having formerly held the citizenship of another EU Member State or a third country or having formerly been a stateless person. 2. One of the possible ways of acquiring citizenship is through naturalisation, which refers more to the decision / administrative process by the relevant authorities for the granting of nationality.
A B act of persecution BG действие на преследване CS akt pronásledování EL πράξη δίωξης EN act of persecution ES act de persecución ET tagakiusamisakt FI vainoksi katsottavat teot FR acte de persécution GA gníomh géarleanúna / iolra: gníomhartha géarleanúna HU üldöz(tet)ésnek minősülő cselekmények IT atto di persecuzione LT persekiojimo veiksmas LV vajāšanas darbība In the global context, acts of human rights abuses or other serious harm, often, but not always, with a systematic or repetitive element. In the EU context and within the meaning of Art. 1A of the Geneva Refugee Convention and Protocol, acts which are a) sufficiently serious by their nature or repetition as to constitute a severe violation of basic human rights, in particular the rights from which derogation cannot be made under Art.15(2) of the European Convention on Human Rights; or b) an accumulation of various measures, including violation of human rights which is sufficiently severe as to affect an individual in a similar manner as mentioned in (a). Source(s) NL daad van vervolging Global context: UNHCR Master Glossary of Terms and EU context: Art. 9 of Directive 2011/95/EU (Recast Qualification Directive) PL prześladowanie Broader term(s) MT Att ta’ persekuzzjoni PT atos de perseguição persecution RO act de persecutie Related term(s) SK čin prenasledovania / akt prenasledovania SL dejanje preganjanja SV förföljelse NO forfølgelseshandlinger (b); forfølgingshandlingar (n) KA დევნის აქტი UK акт переслідування HY հետապնդման որոշում, հետապնդման գործողություն D Definition(s) DE Verfolgungshandlung HR djelo proganjanja C E F G H I J K L M N O actor of persecution or serious harm group persecution serious harm P EMN Asylum and Migration Classification Q 4.1.1 Refugee protection Euro Voc Classification R 12 Law| 2811 migration S Note(s) According to Directive 2011/95/EU (Recast Qualification Directive), acts of persecution can, inter alia, take the form of: a) acts of physical or mental violence, including acts of sexual violence; b) legal, administrative, police, and/or judicial measures which are in themselves discriminatory or which are implemented in a discriminatory manner; c) prosecution or punishment which is disproportionate or discriminatory; d) denial of judicial redress resulting in a disproportionate or discriminatory punishment; e) prosecution or punishment for refusal to perform military service in a conflict, where performing military service would include crimes or acts falling within the scope of the grounds for exclusion as set out in Art. 12(2); f) acts of a gender-specific or child-specific nature T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 29
Action Plan on the integration of third-country nationals BG План за действие относно интеграцията на граждани на трети държави CS Akční plán v oblasti integrace státních příslušníků třetích zemí DE Aktionsplan für die Integration von Drittstaatsangehörigen EL Σχέδιο δράσης για την ένταξη υπηκόων τρίτων χωρών EN Action Plan on the integration of third-country nationals ES Plan de Acción para la integración de los nacionales de terceros países ET Kolmanda riigi kodanike integreerimise tegevuskava Definition(s) Comprehensive framework to support EU Member States’ efforts in developing and strengthening their integration policies. Source(s) European Migration Network: Asylum and Migration glossary - 7th (online) edition, Brussels, January 2020. European Commission Communication: Action Planon the integration of third country nationals, COM(2016) 377 final. Broader term(s) integration FI Kolmansien maiden kansalaisten kotouttamista koskeva toimintasuunnitelma EMN Asylum and Migration Classification FR Plan d’action sur l’intégration des ressortissants de pays tiers Euro Voc Classification GA HR Akcijski plan za integraciju državljana trećih zemalja HU A harmadik országbeli állampolgárok integrációjára vonatkozó cselekvési terv IT Piano d’azione sull’integrazione dei cittadini di paesi terzi LT Trečiųjų šalių piliečių integravimo veiksmų planas LV Rīcības plāns trešo valstu valstspiederīgo integrācijai MT Pjan t’ azzjoni dwar l-integrazzjoni ta’ ċittadini minn pajjiżi terzi. NL Actieplan inzake integratie van onderdanen van derde landen PL Plan działań na rzecz integracji obywateli państw trzecich PT Plano de ação para a integração de nacionais de países terceiros RO Plan de acțiune privind integrarea resortisanților din țările terțe SK Akčný plán pre integráciu štátnych príslušníkov tretích krajín SL akcijski načrt za integracijo državljanov tretjih držav SV Handlingsplan för integration av tredjelandsmedborgare NO Handlingsplan for integrering av tredjelandsborgere KA მესამე ქვეყნის მოქალაქეთა ინტეგრაციის სამოქმედო გეგმა UK План дій з інтеграції громадян третіх країн HY 30 Գործողությունների Ծրագիր երրորդ երկրների քաղաքացիների ինտեգրման մասին EMN ASYLUM AND MIGRATION GLOSSARY 10.0 9.1 Integration measures 2811 migration Note(s) 1. The European Commission adopted the Action Plan on integration on 7 June 2016. Although Member States are primarily responsible for integration, the EU is supporting national and local policies with policy coordination, exchange of knowledge and financial resources. 2. The Plan includes actions across all the policy areas that are crucial for integration: pre-departure and pre-arrival measures, including actions to prepare migrants and the local communities for the integration process; education, including actions to promote language training, participation of migrant children to early childhood education and care, teacher training and civic education; employment and vocational training, including actions to promote early integration into the labour market and migrants entrepreneurship; access to basic services such as housing and healthcare; active participation and social inclusion, including actions to support exchanges with the receiving society, migrants’ participation to cultural life and fighting discrimination. 3. While it targets all third-country nationals in the EU, it contains actions to address the specific challenges faced by refugees. 4. For more information see the Website on Integration of the DG Migration and Home Affairs.
A B active citizenship BG активно гражданско участие CS aktivní občanská participace DE aktive Staatsbürgerschaft / aktive Bürgerbeteiligung EL ενεργός πολιτότητα EN active citizenship ES Ciudadanía activa ET kodanikuaktiivsus FI aktiivinen kansalaisuus FR citoyenneté active GA HR aktivno državljanstvo HU aktív állampolgárság IT cittadinanza attiva LT aktyvus pilietiškumas LV aktīvs pilsoniskums MT Ċittadinanza attiva NL Actief burgerschap PL Aktywne obywatelstwo PT cidadania ativa RO cetățenie activă SK aktívne občianstvo SL aktivno državljanstvo SV aktivt medborgarskap NO medborgerskap (b); medborgarskap (n) KA აქტიური სამოქალაქო მონაწილეობა UK Активне громадянство HY ակտիվ քաղաքացիություն C D Definition(s) Civic and political participation by immigrants and the consequent acquisition and exercise of equal rights and responsibilities. Source(s) Developed by EMN. E F G Broader term(s) H Zaragoza Declaration on Integration EMN Asylum and Migration Classification I 9. Integration Euro Voc Classification 2811 migration J Note(s) K 1. Active citizenship is an umbrella term for the acquisition and exercise of rights for civic and political participation. As such, it includes citizenship and residence, membership in (political) organisations, voting, running for office, volunteering or participation in political protest. For more information see: Using EU Indicators of Immigrant Integration. Final Report for Directorate-General for Home Affairs, March 2013. 2. Active citizenship is one of the four main policy areas identified in the Common Basic Principles (2004) and reaffirmed in the Zaragoza Declaration on Integration of April 2010 as key factors for a successful integration policy, the others are employment, education and social inclusion. For more information see European Website on Integration. 3. For active citizenship the following core indicators have been developed: the share of immigrants that have acquired citizenship - the share of immigrants holding permanent or long-term residence permits; the share of immigrants among elected representatives. The first two indicators have been integrated in the Eurostat Migrant Integration Statistics, for further information see Eurostat Statistics Explained - Migrant integration statistics - active citizenship. 4. As there is no unified view among EU Member States on indicators in the area of active citizenship, there is a different interpretation of active citizenship policies at national level. L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 31
actor of persecution or serious harm BG субект на преследване CS původce pronásledování DE Akteur, von dem eine Verfolgung oder ein ernsthafter Schaden ausgehen kann EL υπεύθυνοι της δίωξης ή της σοβαρής βλάβης EN actor of persecution or serious harm ES agente de persecución ET tagakiusaja FI vainon ja vakavan haitan harjoittaja FR acteur des persécutions ou des atteintes graves GA gníomhaí géarleanúna / iolra: gníomhaithe géarleanúna HR počinitelj proganjanja ili ozbiljne nepravde HU üldöztetés vagy súlyos sérelem forrása IT responsabile di persecuzione o danni gravi LT persekiojimo vykdytojas LV vajāšanas vai smaga kaitējuma nodarīšanas dalībnieks MT Awtur t’atti ta’ persekuzzjoni jew offiżi serji NL actor van vervolging of ernstige schade PL prześladowca PT agente de perseguição RO agent de persecuție sau vătămări grave SK pôvodca prenasledovania alebo vážneho bezprávia / aktér prenasledovania alebo vážneho bezprávia SL subjekt preganjanja ali resne škode SV aktörer som utövar förföljelse NO aktører som er ansvarlig for forfølgelse / aktører som utøver forfølgelse (b); aktørar som er ansvarlege for forfølging / aktørar som utøver forfølging (n) KA დევნის განმახორციელებელი ან სერიოზული ზიანის მიმყენებელი სუბიექტი UK суб’єкт переслідування або заподіяння серйозної шкоди HY 32 հետապնդման կամ լուրջ վնասի գործողության պատճառման մասնակից EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Definition(s) Any person (individual or legal) causing persecution or serious harm, such as: a) the State; b) parties or organisations controlling the State or a substantial part of the territory of the State; c) non-State actors, if it can be demonstrated that the actors mentioned in (a) and (b), including international organisations, are unable or unwilling to provide protection against persecution or serious harm as defined in Art.7 of Directive 2011/95/EU (Recast Qualification Directive). Source(s) Art. 6 of Directive 2011/95/EU (Recast Qualification Directive) Broader term(s) persecution serious harm Related term(s) act of persecution group persecution EMN Asylum and Migration Classification 4.1 International protection Euro Voc Classification 12 Law| 2811 migration
A B actor of protection BG субект на закрила C D Definition(s) CS poskytovatel ochrany FI suojelun tarjoaja Any person (individual or legal) providing effective and non-temporary protection against persecution or serious harm such as a) the State or b) parties or organisations, including international organisations, controlling the State or a substantial part of the territory of the State provided they are willing and able to offer protection. FR acteur de la protection Source(s) DE Akteur, der Schutz bieten kann EL υπεύθυνος προστασίας EN actor of protection ES agente de protección ET kaitset tagav isik HR pružatelj zaštite protection IT soggetto responsabile della protezione 4.1 International protection LV aizsardzības dalībnieks L Euro Voc Classification MT Aġent responsabbli għall-protezzjoni NL actor van bescherming PL podmiot udzielający ochrony PT agente de proteção 1231 international law| 2811 migration M Note(s) N Such protection is generally provided when the actors mentioned under points (a) and (b) of paragraph 1 take reasonable steps to prevent the persecution or suffering of serious harm, inter alia, by operating an effective legal system for the detection, prosecution and punishment of acts constituting persecution or serious harm, and when the applicant has access to such protection. RO agent de protectie SK aktér ochrany SL subjekt zaščite H K EMN Asylum and Migration Classification LT apsaugos teikėjas G J Broader term(s) HU védelmet nyújtó F I Derived by EMN from Art. 7 of Directive 2011/95/EU (Recast Qualification Directive) GA gníomhaí cosanta (iolra: gníomhaithe cosanta) E SV aktörer som ger skydd O P NO aktører som gir beskyttelse (b); aktørar som gjev vern (n) Q KA დაცვის განმახორციელებელი სუბიექტი R UK суб’єкт захисту HY S պաշտպանության կողմնակից T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 33
adaptation BG приспособяване CS adaptace Definition(s) DE Anpassung / Adaptation Process of modifying some or all of one’s beliefs and / or attitudes so as to suit new conditions of life. EL προσαρμογή Source(s) EN adaptation UNHCR International Thesaurus of Refugee Terminology ES adaptación Related term(s) ET kohanemine integration FI sopeutuminen EMN Asylum and Migration Classification FR adaptation 9. Integration GA oiriúnú Euro Voc Classification HR prilagodba HU adaptáció / alkalmazkodás IT adattamento LT adaptacija LV pielāgošanās MT Addattament NL aanpassing PL adaptacja PT adaptação RO adaptare SK prispôsobenie / adaptácia SL prilagajanje SV anpassning NO tilpasning (b); tilpassing (n) KA ადაპტაცია UK адаптація HY 34 ադապտացիա (հարմարվողականություն) EMN ASYLUM AND MIGRATION GLOSSARY 10.0 2811 migration
A B admissibility interview BG интервю за допустимост C D Definition(s) CS pohovor o přípustnosti DE Anhörung im Rahmen der Zulässigkeitsprüfung EL συνέντευξη επί του παραδεκτού αίτησης EN admissibility interview ES entrevista de admisibilidad / entrevista de admisión a tramite ET vastuvõetavuse vestlus E Personal interview in an admissibility procedure or in specific cases laid down in Art. 33 of Directive 2013/32/EU (Recast Asylum Procedures Directive) allowing applicants for international protection to present their views with regard to their particular circumstances and on the inadmissibility grounds before the determining authority decides on the admissibility of the application. F G H Source(s) FI tutkittavaksiottamispuhuttelu I Derived by EMN from Art. 33 and Art. 34 of Directive2013/32/EU (Recast Asylum Procedures Directive) FR entretien sur la recevabilité (de la demande) GA agallamh inghlacthachta HR saslušanje za utvrđivanje dopustivosti zahtjeva J Broader term(s) HU elfogadhatósági meghallgatás IT colloquio sull’ammissibilità admissibility of an application for international protection K LT pokalbis dėl priimtinumo Related term(s) L EMN Asylum and Migration Classification M Euro Voc Classification N LV intervija par pieteikuma pieņemamību, sākotnējā intervija inadmissible application for international protection MT ntervista dwar l-ammissibilità 6.2.1 Access to the international protection procedure NL persoonlijk onderhoud in het kader van de ontvankelijkheidsprocedure (BE) ontvankelijkheidsinterview (NL) 1011 European Union law| 2811 migration PL przesłuchanie dotyczące dopuszczalności PT entrevista relativa à admissibilidade do pedido RO interviu privind admisibilitatea SK pohovor o prípustnosti SL razgovor o dopustnosti SV intervju för att avgöra om ansökan ska tas upp till prövning NO intervju for å få å avklare en søknad (b); intervju for å avklara ein søknad (n) KA გასაუბრება საერთაშორისო დაცვის მოთხოვნის შესახებ განცხადების დასაშვებობის თაობაზე O Note(s) 1. Admissibility procedures are conducted when an EU Member State does not have to examine whether an applicant qualifies for international protection because of specific circumstances or the inadmissibility grounds laid down in Art 33 of Directive 2013/32/EU. These are: ƒ another EU Member State is responsible for the application under the Dublin III Regulation; ƒ another EU Member State has already granted protection; ƒ another country is considered to be the first country of asylum or a safe third country for the applicant; ƒ the application is a subsequent one with no new elements; or ƒ a dependent lodges an application after consenting to be a part of an application. 2. EU Member States do not need to examine an application for international protection on its merits in order to determine whether the application can still be admitted for examination. Q R S T U UK Співбесіда щодо допустимості HY P դիմումի ընդունելության հարցազրույց V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 35
admissibility of an application for international protection BG допустимост на молба за международна закрила CS přípustnost žádosti o mezinárodní ochranu DE Zulässigkeit eines Antrags auf internationalen Schutz EL παραδοχή αίτησης διεθνούς προστασίας EN admissibility of an application for international protection ES Definition(s) Prerequisite of an application for international protection to comply with the requirements necessary to be accepted for examination to decide whether the applicant qualifies as a beneficiary of international protection. Source(s) ET rahvusvahelise kaitse taotluse vastuvõetavus Derived by EMN from the EASO definition in the context of CdT Terminology Coordination Project FI kansainvälistä suojelua koskevan hakemuksen perusteen tutkittavaksi ottaminen Narrower term(s) FR recevabilité d’une demande de protection internationale Related term(s) GA inghlacthacht iarratais ar chosaint idirnáisiúnta HR dopuštenost zahtjeva za međunarodnu zaštitu HU nemzetközi védelem iránti kérelem elfogadhatósága IT Ammissibilità di una domanda di protezione internazionale LT tarptautinės apsaugos prašymo priimtinumas LV starptautiskās aizsardzības pieteikuma pieņemamība MT NL ontvankelijkheid van een verzoek om internationale bescherming PL dopuszczalność wniosku o udzielenie ochrony międzynarodowej PT admissibilidade de um pedido de proteção internacional RO admisibilitate a cererii de protecție internațională SK prípustnosť žiadosti o medzinárodnú ochranu SL dopustnost prošnje za mednarodno zaščito SV fråga om en ansökan om internationellt skydd kan tas upp till prövning NO avklaring av en søknad om beskyttelse (b); avklaring av ein søknad om vern (n) KA საერთაშორისო დაცვის მოთხოვნის შესახებ განცხადების დასაშვებობა UK допустимість заяви про надання міжнародного захисту HY 36 միջազգային պաշտպանության դիմումի ընդունումը EMN ASYLUM AND MIGRATION GLOSSARY 10.0 admissibility interview inadmissible application for international protection EMN Asylum and Migration Classification 6.2.3 First Instance (Administrative) determination procedure Euro Voc Classification 1011 European Union law| 2811 migration
A B admission onto the territory BG допускане на територията CS povolení ke vstupu na území EL εισδοχή στην επικράτεια (EL); εισδοχή στο έδαφος (CY) ES entrada legal al territorio ET riiki lubamine FI maahantulon salliminen FR admission sur le territoire GA cead isteach sa chríoch HR zakonit ulazak u zemlju HU egy állam területére történő befogadás IT ammissione sul territorio LT įleidimas į teritoriją LV uzņemšana teritorijā MT Dħul fit-territorju NL toegang tot het grondgebied D Definition(s) DE Zulassung zum Hoheitsgebiet EN admission onto the territory C The lawful entry of an alien onto the territory of a State after inspection and authorisation by an immigration officer. Source(s) F Derived by EMN from the definition of ‘admission (into a State)’ in IOM Glossary on Migration, 2019. G Broader term(s) H EMN Asylum and Migration Classification I Euro Voc Classification J legal entry 6.1 Entry Conditions and Procedures 2811 migration K Note(s) In countries signatory to the Schengen Agreement, only citizens from countries which are not signatory to the Schengen Agreement have to go through the admission process, whereas in non-Schengen countries all non-nationals have to be admitted. PL przyjęcie / dopuszczenie na terytorium L M N PT entrada no território RO admisie pe teritoriu O SK povolenie vstupu na územie štátu SL sprejem na ozemlje P SV tillstånd att resa in i landet NO adgang til riket (b); tilgjenge til riket (n) Q KA ტერიტორიაზე დაშვება R UK допуск на територію HY E պետություն մուտք գործելու իրավունքի թույլտվություն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 37
adoption (of a child) BG осиновяване CS osvojení (dítěte) DE Adoption (eines Kindes) EL υιοθεσία (παιδιού) EN adoption (of a child) ES adopción ET lapsendamine FI adoptio FR adoption (d’un enfant) GA uchtú; uchtáil HR posvojenje (djeteta) HU örökbefogadás IT adozione (di un bambino) LT įvaikinimas LV adopcija MT Addozzjoni NL adoptie PL adopcja PT adoção RO adopție (a unui copil) SK osvojenie / adopcia (dieťaťa) SL posvojitev SV adoption NO adopsjon KA შვილად აყვანა UK усиновлення (дитини) HY 38 որդեգրում (երեխայի) EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Definition(s) In the context of dependants, the statutory process of terminating legal rights and duties between the child and the natural parents, and substituting similar rights and duties between the child and the adoptive parents. Source(s) IOM Glossary on Migration 2019 Narrower term(s) adoption of convenience EMN Asylum and Migration Classification 7.2 Minors and unaccompanied minors Euro Voc Classification 12 Law
A B adoption (of legal acts) BG приемане CS přijetí (právních aktů) DE Annahme (von Rechtsakten) EL υιοθέτηση (νομοθετικών πράξεων) (EL); θέσπιση (νομοθετικών πράξεων) (CY) In the context of accords, in public international law, the formal act by which negotiating parties establish the form and content of a treaty. Source(s) Derived by EMN from IOM Glossary on Migration, 2019. ES adopción EMN Asylum and Migration Classification ET (õigusakti) vastuvõtmine 2. Legal and Political Framework of Migration FI hyväksyminen Euro Voc Classification GA glacadh HR usvajanje (pravnog akta) HU elfogadás IT adozione (di atti giuridici) LT (susitarimo) priėmimas D Definition(s) EN adoption (of legal acts) FR adoption (d’actes législatifs) C F G H 12 Law I Note(s) J The treaty is adopted through a specific act expressing the will of the states and the international organisations participating in the negotiation of that treaty, e.g. by voting on the text, initialling, signing, etc. Adoption may also be the mechanism used to establish the form and content of amendments to a treaty, or regulations under a treaty. LV pieņemšana MT Aċċettazzjoni K L M NL goedkeuring N PL przyjęcie PT aprovação O RO adoptie (a unui act juridic) SK prijatie (právnych aktov) P SL sprejetje SV antagande Q NO godkjenning KA სამართლებრივი აქტების მიღება R UK прийняття (правових актів) HY E S ընդունում (օրենսդրական գործերի/ակտերի) T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 39
adoption of convenience BG no translation CS účelové osvojení DE Scheinadoption EL εικονική υιοθεσία EN adoption of convenience ES adopción de conveniencia ET mugavuslapsendamine FI harhautustarkoituksessa toteutettu adoptio FR adoption de complaisance GA uchtú áise HR posvojenje iz koristi HU névleges örökbefogadás IT adozione fittizia LT fiktyvus įvaikinimas LV fiktīva adopcija MT Addozzjoni ta’ konvenjenza NL schijnadoptie PL adopcja fikcyjna PT adopção de conveniência RO adoptie de convenienta SK účelové osvojenie SL posvojitev iz koristoljubja SV skenadoption NO proformaadopsjon KA ფიქციურად შვილად აყვანა UK фіктивне усиновлення HY 40 պայմանական որդեգրում EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Definition(s) An adoption (of a child) contracted for the sole purpose of enabling the person adopted to enter or reside in an EU Member State. Source(s) Art. 16(2b) of Council Directive 2003/86/EC (Family Reunification Directive) Related term(s) civil partnership of convenience marriage of convenience partnership of convenience EMN Asylum and Migration Classification 7.2 Minors and unaccompanied minors Euro Voc Classification 2811 migration
A B adult BG възрастен CS dospělá osoba DE Erwachsener EL ενήλικας EN adult ES adulto ET täisealine / täiskasvanu FI aikuinen FR adulte GA aosach HR odrasla osoba HU felnőtt IT adulto / maggiorenne LT pilnametis LV pieaugušais C D Definition(s) Every human being aged 18 years and older (unless majority is attained later under the law applicable to the adult). Source(s) F Derived by EMN from the definition of ‘child’ in EMN Glossary G Related term(s) H child minor I Euro Voc Classification 2806 family| 2811 migration J Note(s) K Adulthood can be defined in terms of biology, psychological adult development, law, personal character or social status. For the purposes of this glossary, a more legal definition is used. MT Adult(a) L M NL volwassene PL osoba pełnoletnia N PT adulto / maior de idade RO adult O SK dospelá osoba SL odrasla oseba / polnoletna oseba P SV vuxen NO voksen (b); vaksen (n) Q KA სრულწლოვანი R UK дорослий HY E չափահաս S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 41
advance passenger information (API) BG Предварителна информация за пътниците CS předem předané údaje o cestujících DE Vorabinformationen über die beförderte Person / Vorabdaten über die beförderte Person / VorabPassagier-Informationssystem EL εκ των προτέρων διαβίβαση πληροφοριών σχετικά με επιβάτες (API) (EL); δεδομένα API (CY) EN advance passenger information (API) ES información anticipada del pasajero Definition(s) Information concerning the passengers whom carriers will transport to an authorised border crossing point through which these persons will enter the territory of an Schengen Member State, which carriers are obliged to transmit, by end of check-in, at the request of the authorities responsible for carrying out checks on persons at external EU borders. Source(s) FI matkustajien ennakkotiedot Derived by EMN from Art.3 of Council Directive 2004/82/EC (Directive on the obligation of carriers to communicate passenger data) FR informations préalables sur les passagers Synonym(s) ET reisijate eelandmed GA Réamhfhaisnéis faoi Phaisinéirí HR prethodno dostavljeni podaci o putnicima HU előzetes utasinformáció IT informazioni anticipate sui passeggeri LT išankstinė informacija apie keleivius LV iepriekšēja pasažieru informācija MT Tagħrif bil-quddiem dwar il-passiġġieri NL vooraf te verstrekken passagiersgegevens PL dane pasażera przekazywane przed podróżą PT Sistema Avançado de Informação sobre Passageiros RO informații prealabile referitoare la pasageri (API) SK vopred poskytované informácie o cestujúcich (API) SL predhodni podatki o potnikih SV förhandsuppgifter om passagerare NO Forhåndsvarsel om passasjerer (b); Førehandsvarsel om reisande (n) KA მგზავრის წინასწარი მონაცემები (API) UK попередня інформація про пасажира (API) HY 42 ուղեւորի մասին նախապես տրված տվյալներ EMN ASYLUM AND MIGRATION GLOSSARY 10.0 advance passenger data API APIS Advance Passenger Information System EMN Asylum and Migration Classification 6.1 Entry Conditions and Procedures Euro Voc Classification 2811 migration Note(s) This information comprises: the number and type of travel document used, nationality, full names, the date of birth, the border crossing point of entry into the territory of the Schengen Member States, mode of transport, departure and arrival time of the transportation, total number of passengers carried on that transport, the initial point of embarkation.
Africa Caribbean Pacific (ACP) Observatory on Migration BG Обсерватория по миграция за страните от Африка, Карибите и Тихоокенския басейн CS Observatoř pro migraci států Afriky, Karibiku a Pacifiku DE Beobachtungsstelle für Migration in Afrika, in der Karibik und im pazifischen Raum EL Παρατηρητήριο των χωρών ΑΚΕ (Αφρικής, Καραϊβικής και Ειρηνικού) για τη Μετανάστευση EN Africa Caribbean Pacific Observatory on Migration ES Observatorio sobre Migraciones Africa Caribe Pacífico ET Aafrika, Kariibi mere ja Vaikse ookeani piirkonna riikide rände vaatluskeskus FI Afrikan, Karibian ja Tyynenmeren alueen muuttoliikkeiden seurantakeskus A B C D Definition(s) A reference network of migration research institutions and governmental entities dealing with migration in the six regions of the Africa Caribbean Pacific (ACP) Group of States, namely West Africa, Central Africa, East Africa, Southern Africa, the Caribbean and the Pacific, designed to produce data on South-South ACP migration flows for civil society and policy-makers, and enhance research capacities in ACP countries through networking and cooperation among organisations. E Source(s) I Website of the Organisation of African, Caribbean and Pacific States (OACPS) GA Faireachlann Stáit na hAfraice, Mhuir Chairib agus an Aigéin Chiúin um Imirce, Faireachlann ACC um Imirce HR Promatračka skupina za migracije Afrike, Kariba i Pacifika (AKP) HU Afrikai, Karibi és Csendes-óceáni Migrációs Megfigyelő Központ K Related term(s) L M EMN Asylum and Migration Classification LT Afrikos, Karibų ir Ramiojo vandenyno regiono migracijos stebėsenos tinklas LV Āfrikas, Karību jūras reģiona un Klusā okeāna valstu Migrācijas novērošanas centrs MT Osservatorju (L-) tal-Afrika, Karibew u Paċifiku fuq il-Migrazzjoni NL Africa Caribbean Pacific Observatory on Migration PL Obserwatorium Migracji państw Afryki, Karaibów i Pacyfiku N 15.1 EU External dimension of migration and mobility Euro Voc Classification 2811 migration| 7616 extra-European Organisations O Note(s) P 1. The ACP was established in 2010 on the initiative of the Secretariat of the ACP Group of States, empowered by the International Organization for Migration (IOM) and funded by the European Union with the financial support of CH. 2. Activities are undertaken in 12 pilot countries (Angola, Cameroon, the Democratic Republic of the Congo, Haiti, Kenya, Lesotho, Nigeria, Papua New Guinea, Senegal, Tanzania, TimorLeste and Trinidad and Tobago). https://www.oacps.org/3. For more information see the Webpage of the Organisation of African, Caribbean and Pacific States (OACPS). PT Observatório ACP das Migrações H ACP ACP Observatory on Migration European Migration Network (EMN) Global Approach to Migration and Mobility (GAMM) IT Osservatorio Africa, Caraibi e Pacifico sulle migrazioni G J Synonym(s) FR Observatoire Afrique, Caraïbes, Pacifique sur les migrations F RO Observator cu privire la migratie Africa Caraibe Pacific / Observator cu privire la migrație Africa, zona Caraibilor și Pacific (ACP) SK Observatórium Skupiny afrických, karibských a tichomorských (ACP) štátov pre migráciu SL Observatorij afriških, karibskih in pacifiških držav za migracije SV Africa Caribbean Pacific Observatory on Migration (no usual translation) NO Africa Caribbean Pacific Observatory on Migration (no usual translation) KA აფრიკის, კარიბის ზღვის აუზისა და წყნარი R S T U V W X Y ოკეანის ქვეყნების (ACP) მიგრაციის საინფორმაციო-კვლევითი ცენტრი Z UK Обсерваторія з міграції країн Африки, Карибського басейну та Тихоокеанського регіону HY Աֆրիկական, Կարիբյան և Խաղաղօվկիանոսյան երկրների ներգաղթի (միգրացիայի) հետազոտական կենտրոն (ցանց) EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Q 43
Africa-EU Migration, Mobility and Employment Partnership BG Партньорство за миграция, мобилност и заетост между страните на Африка и ЕС MT Sħubija bejn l-Afrika u l-UE dwar Migrazzjoni, Mobilità u Impiegi CS Partnerství EU-Afrika pro migraci, mobilitu a zaměstnanost NL Afrika-EU-Partnerschap inzake migratie, mobiliteit en werkgelegenheid DE Afrika-EU Partnerschaft in den Bereichen Migration, Mobilität und Beschäftigung PL Partnerstwo UE-Afryka na rzecz migracji, mobilności i zatrudnienia EL εταιρική σχέση ΕΕ-Αφρικής για τη µετανάστευση, την κινητικότητα και την απασχόληση PT Parceria Africa-UE para as migrações, mobilidade e emprego EN Africa-EU Migration, Mobility and Employment Partnership RO Parteneriatul Africa-UE cu privire la migraţie mobilitate şi angajare / Parteneriatul Africa-UE cu privire la migrație, mobilitate și ocuparea forței de muncă ES Asociación África-UE sobre migración, movilidad y empleo ET Aafrika-EL migratsiooni, mobiilsuse ja tööhõive partnerlus FI Afrikan ja EU:n kumppanuus muuttoliikkeen, liikkuvuuden ja työllisyyden aloilla FR Partenariat Afrique-UE sur les migrations, la mobilité et l’emploi GA Comhpháirtíocht an AE agus na hAfraice maidir le hImirce, Soghluaisteacht agus Fostaíocht HR Partnerstvo EU-a i Afrike za migracije, mobilnost i zapošljavanje HU Afrika-EU közötti Migrációs, Mobilitási és Foglalkoztatási Partnerség IT Partenariato Africa-UE in materia di Migrazione, Mobilità e Occupazione LT ES-Afrikos partnerystė migracijos, mobilumo ir užimtumo srityse LV Āfrikas un ES Migrācijas, mobilitātes un nodarbinātības partnerība 44 EMN ASYLUM AND MIGRATION GLOSSARY 10.0 SK Partnerstvo Afrika - EÚ v oblasti migrácie, mobility a zamestnanosti SL Partnerstvo med Afriko in EU na področju migracij, mobilnosti in zaposlovanja SV MME-partnerskapet (migration, rörlighet och sysselsättning) NO Afrika–EU migrasjons-, mobilitets- og sysselsettings­ partnerskap (b); Afrika–EU migrasjons-, mobilitets- og sysselsetjingspartnarskap KA აფრიკა-ევროკავშირის პარტნიორობა მიგრაციის, მობილობისა და დასაქმების სფეროებში UK Партнерство Африки - ЄС у сфері міграції, мобільності та зайнятості HY Աֆրիկա-ԵՄ-ի Ներգաղթի (միգրացիայի), Շարժունակության և Աշխատանքային գործընկերություն
A B C D Definition(s) E A partnership that provides comprehensive responses to the issues of migration, mobility and employment, in the interest of all partners, with the particular objectives to create more and better jobs for Africa and to better manage migration flows. F G Source(s) Website of the Africa-EU Partnership H Synonym(s) Africa-EU MME Partnership MME Partnership I Related term(s) J Dialogue on Mediterranean Transit Migration Global Approach to Migration and Mobility (GAMM) K EMN Asylum and Migration Classification 15.1 EU External dimension of migration and mobility L Euro Voc Classification 2811 migration| 7616 extra-European Organisations M Note(s) N 1. The MME Partnership was launched during the 2nd Africa-EU Summit of Heads of State and Government in December 2007 in Lisbon, where the Joint EU-Africa Strategy and the First Action Plan (2008-2010) were adopted. 2. The partnership aims to ensure sustainable development and the implementation of relevant international agreements and declarations, relying in particular on the Tripoli Declaration on Migration and Development, the Ouagadougou Action Plan to Combat Trafficking in Human Beings, especially Women and Children and the Ouagadougou Declaration and Plan of Action for Promotion of Employment and Poverty Alleviation. 3. It covers one of the eight areas of cooperation of the Africa-EU (Strategic) Partnership, which is the formal channel through which the European Union and the African Union work together, and which provides the overarching long-term framework for Africa-EU relations. 4. For more information, see the webpage of the Africa-EU Partnership. O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 45
age assessment BG оценка на възрастта CS určení věku DE Altersfeststellung / Altersbestimmung EL υπολογισμός ηλικίας (EL); προσδιορισμός ηλικίας (CY) EN age assessment ES determinación de la edad ET vanuse määramine FI iän määrittäminen FR détermination de l’âge GA measúnú aoise HR procjena starosne dobi HU kormeghatározás IT accertamento dell’età Definition(s) Process by which authorities seek to establish the chronological age, or range of age, of a person in order to determine whether an individual is a child or not. Source(s) Derived by EMN from EASO: Practical guide on age assessment. - 2nd. edition, 2018. Related term(s) child minor EMN Asylum and Migration Classification 7.2 Minors and unaccompanied minors Euro Voc Classification 2806 family| 2811 migration LT amžiaus nustatymas LV vecuma noteikšana MT Valutazzjoni / Stima tal-età NL leeftijdsonderzoek PL ustalenie / ocena wieku PT determinação da idade RO evaluarea varstei SK posúdenie veku SL ugotavljanje starosti SV åldersbedömning NO aldersvurdering KA ასაკის დადგენა UK оцінка віку HY 46 տարիքի գնահատում EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Note(s) 1. Art. 4 (3a) of Council Resolution of 26 June 1997 on unaccompanied minors states that in principle, unaccompanied asylum-seekers claiming to be minors must produce evidence of their age. If such evidence is not available or serious doubt persists, EU Member States may carry out an age assessment. Age assessment should be carried out objectively. For such purposes, EU Member States may have a medical age-test carried out by qualified medical personnel, with the consent of the minor, a specially appointed adult representative or institution. 2. According to UN Committee on the Rights of the Child, General Comment No. 6, the identification of a child as an unaccompanied and separated child (UASC) includes age assessment, which should take into account physical appearance, but also psychological maturity. The assessment must be conducted in a scientific, safe, child and gender-sensitive and fair manner, avoiding any risk of violation of the physical integrity of the child, giving due respect to human dignity. 3. Age assessment can include a variety of processes or procedures either undertaken singularly or in combination, such as: analysis of documentary evidence, interview, X-ray, physical or other form of medical examination.
A B airport transit visa BG виза за летищен транзит CS letištní průjezdní vízum C D Definition(s) DE Visum für den Flughafentransit A visa valid for transit through the international transit areas of one or more airports of the EU Member States. E EL θεώρηση διέλευσης από αερολιμένα Source(s) F EN airport transit visa ES visado de tránsito aeroportuario ET lennujaama transiidiviisa FI lentokentän kauttakulkuviisumi FR visa de transit aéroportuaire GA víosa idirthurais aerfoirt HR zrakoplovno-tranzitna viza HU repülőtéri tranzit vízum IT visto di transito aeroportuale LT oro uosto tranzitinė viza LV lidostas tranzītvīza Art. 2(m) of Regulation (EU) No 604/2013 (Dublin III Regulation) G Broader term(s) H visa Related term(s) long-stay visa short-stay visa I EMN Asylum and Migration Classification J Euro Voc Classification K 6.1.2 Visa policy 2811 migration L MT Viża għat-transitu fl-ajruport M NL luchthaventransitvisum PL lotniskowa wiza tranzytowa N PT visto de trânsito aeroportuário RO viza de tranzit aeroportuar O SK letiskové tranzitné vízum SL letališki tranzitni vizum P SV visering för flygplatstransitering NO transittvisum for lufthavn (b); transittvisum for lufthamn (n) Q KA აეროპორტის სატრანზიტო ვიზა R UK транзитна віза аеропорту HY S օդանավակայանի տարանցիկ վիզա T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 47
alien BG чужденец CS cizinec DE Ausländer EL αλλοδαπός EN alien ES extranjero ET välismaalane FI ulkomaalainen FR étranger GA eachtrannach Definition(s) In the global context, a person who is not a national (native or citizen) of a given State. In the EU context, a person who is not a national of an EU Member State. Source(s) Global context: Derived by EMN from IOM Glossary on Migration, 2019. EU context: Schengen acquis Synonym(s) HU külföldi foreigner non-citizen non-national IT straniero Related term(s) HR stranac LV ārvalstnieks non-EU national third-country national MT Persuna barranija / għariba EMN Asylum and Migration Classification LT užsienietis NL vreemdeling 2.4 National PL cudzoziemiec Euro Voc Classification PT estrangeiro RO străin SK cudzinec SL tujec SV utlänning NO utlending / utenlandsk borger (b); utlending / utanlandsk borgar (n) KA უცხოელი UK іноземець HY 48 օտարերկրացի EMN ASYLUM AND MIGRATION GLOSSARY 10.0 12 Law| 2811 migration Note(s) The more frequently used term in the EU context is third-country national.
A B alternative to detention BG алтернатива на задържане C D Definition(s) CS alternativa k zajištění DE Alternative zur Inhaftierung / Alternative zur Inhaftnahme / Haftalternative ; Alternative zur Schubhaft / gelinderes Mittel (AT) Non-custodial measure used to monitor and / or limit the movement of third-country nationals in order to ensure compliance with international protection and return procedures. E EL εναλλακτικά της κράτησης μέτρα Source(s) G Derived by EMN from Art. 8(4) of Directive 2013/33/EU (Recast Reception Conditions Directive) EN alternative to detention ES alternativas al internamiento detention FI säilöönotolle vaihtoehtoiset turvaamistoimet 11. Detention and Alternatives to Detention GA malairt ar choinneáil (iolra: malairtí ar choinneáil) HU a fogvatartás alternatívái IT disposizione alternativa al trattenimento LT alternatyvi sulaikymui priemonė LV alternatīva aizturēšanai MT Alternattiva għad-detenzjoni NL alternatief voor bewaring (NL); alternatief voor detentie (BE) PL alternatywa wobec zatrzymania PT alternativa à detenção RO alternativa la masura detentiei SK alternatíva k zaisteniu / alternatíva zaistenia SL alternativa pridržanju / alternativa odvzemu prostosti UK альтернатива триманню під вартою HY կալանքի այլընտրանքային միջոց J Euro Voc Classification HR alternativa detenciji/alternativa ograničenju slobode kretanja KA დაკავების ალტერნატივა I EMN Asylum and Migration Classification FR alternative à la rétention SV alternativ till förvar H Related term(s) ET kinnipidamise alternatiivid NO alternativ til forvaring F 2811 migration K Note(s) L 1. As a general principle the consideration of alternatives to detention is only relevant and legal when there are legitimate grounds to detain third-country nationals (For more information see the entry of detention in this glossary). Alternatives to detention usually provide more favourable (‹less coercive›) conditions for the potential detainee, and may also be more cost-efficient. 2. The alternatives, many of which can be used in combination with each other, can be broadly grouped under the following categories: obligation to surrender passports or travel documents; residence restrictions which impose the duty of remaining at a particular address or residing within a specific geographical area often combined with regular reporting requirements. The designated places can be open or semi-open facilities run by the government or NGOs, as well as hotels, hostels or private addresses. The regime imposed can vary, but people generally have to be present at the designated location at certain times, while absences are usually only allowed with a well-founded justification; release on bail and provision of sureties by third parties; supervision which obliges people to report to the police or immigration authorities at regular intervals, and which is one of the more frequent alternatives to detention found in national legislation. Reporting duties on a daily, bi-weekly, weekly or even less frequent basis may also be imposed as an additional requirement to the obligation to reside at a specified place; placement in open facilities with caseworker support which is an innovative alternative to detention; asylum seekers or people in return procedures are placed in open facilities and provided with individual coaches or counsellors to inform and advise them about their situation and options; electronic monitoring which is the most intrusive of the various alternatives to detention as it substantially interferes with a person’s right to privacy, restricts freedom of movement and can have a negative impact on their dignity. It can also lead to discrimination through the potential association of people wearing an electronic device with criminals. 3. Reception facilities can be considered an alternative to detention only in cases where the individual concerned has to report regularly to the competent authorities, or if there are residency requirements. 4. For further information see EMN: Use of detention and alternatives to detention in the context of immigration policies, 2014 and EMN: Detention and Alternatives to detention in international protection and return procedures, 2021. M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 49
applicant for international protection BG кандидат за международна закрила CS žadatel o mezinárodní ochranu Definition(s) EL αιτών διεθνή προστασία (EL); αιτητής διεθνούς προστασίας (CY) A third-country national or a stateless person who has made an application for international protection in respect of which a final decision has not yet been taken. EN applicant for international protection Source(s) DE Antragsteller auf internationalen Schutz ES solicitante de protección internacional ET rahvusvahelise kaitse taotleja FI kansainvälistä suojelua hakeva FR demandeur de protection internationale GA iarratasóir ar chosaint idirnáisiúnta HR tražitelj međunarodne zaštite HU nemzetközi védelmet kérelmező IT richiedente protezione internazionale LT tarptautinės apsaugos prašytojas (EU acquis); prieglobsčio prašytojas Art. 2(i) of Directive 2011/95/EU (Recast Qualification Directive) Narrower term(s) applicant in need of special procedural guarantees applicant with special reception needs asylum seeker rejected applicant for international protection examination of an application for international protection Related term(s) LV starptautiskās aizsardzības pieteikuma iesniedzējs beneficiary of international protection person eligible for subsidiary protection MT Applikant(a) għall-protezzjoni internazzjonali EMN Asylum and Migration Classification NL verzoeker om internationale bescherming 4.1 International protection PL wnioskodawca o udzielenie ochrony międzynarodowej Euro Voc Classification PT requerente de proteção internacional RO solicitant de protecție internațională SK žiadateľ o medzinárodnú ochranu (EU acquis) SL prosilec za mednarodno zaščito SV sökande av internationellt skydd NO person som søker om internasjonal beskyttelse (b) / person som søkjer om internasjonalt vern (n) KA განმცხადებელი საერთაშორისო დაცვაზე UK заявник на міжнародний захист HY 50 միջազգային պաշտպանության դիմորդ EMN ASYLUM AND MIGRATION GLOSSARY 10.0 2811 migration
applicant in need of special procedural guarantees BG кандидат, който се нуждае от специални процедурни гаранции A B C D Definition(s) CS žadatel, který potřebuje zvláštní procesní záruky DE Antragsteller, der besondere Verfahrensgarantien benötigt EL αιτών που χρήζει ειδικών διαδικαστικών εγγυήσεων (EL); αιτητής που χρήζει ειδικών διαδικαστικών εγγυήσεων (CY) An applicant whose ability to benefit from the rights and obligations provided for in Directive 2013/32/EU (Recast Asylum Procedures Directive) is limited due to individual circumstances. E Source(s) G Art. 2(d) of Directive 2013/32/EU (Recast Asylum Procedures Directive) EN applicant in need of special procedural guarantees H Broader term(s) ES solicitante que necesita garantías procedimentales especiales applicant for international protection I Related term(s) ET spetsiaalseid menetlustagatisi vajav taotleja applicant with special reception needs FI hakija, joka tarvitsee erityisiä menettelyllisiä takeita J EMN Asylum and Migration Classification FR demandeur nécessitant des garanties procédurales spéciales 4.1 International protection| 7. Vulnerable Groups K Euro Voc Classification GA iarratasóir a bhfuil sainráthaíochtaí nós imeachta de dhíth air F L 2811 migration HR tražitelj međunarodne zaštite kojemu su potrebna posebna postupovna jamstva M HU különleges eljárási garanciákat igénylő kérelmező IT richiedente protezione internazionale che necessita di garanzie procedurali particolari N LT prašytojas, kuriam reikia specialių procesinių garantijų (EU acquis); prašytojas, kuriam reikia specialių procedūrinių garantijų O P LV pieteikuma iesniedzējs, kuram nepieciešamas īpašas procesuālās garantijas Q MT Applikant(a) bi ħtieġa / fil-bżonn ta’ garanziji proċedurali speċjali R NL verzoeker die bijzondere procedurele waarborgen behoeft S PL wnioskodawca wymagający specjalnych gwarancji proceduralnych T PT requerente com necessidade de garantias processuais especiais RO solicitant care mecesita garantii procedurale speciale U SK žiadateľ, ktorý potrebuje osobitné procesné záruky (EU acquis) V SL prosilec, ki potrebuje posebna postopkovna jamstva SV sökande i behov av särskilda förfarandegarantier W NO søker som har behov for særskilt saksbehandlingsprosedyre (b); søkjar som treng særskild sakshandsamingsprosedyre (n) X KA განსაკუთრებული პროცედურული გარანტიების Y UK заявник, який потребує особливих процедурних гарантій Z საჭიროების მქონე განმცხადებელი HY հատուկ ընթացակարգային երաշխիքների կարիքը ունեցող դիմորդ EMN ASYLUM AND MIGRATION GLOSSARY 10.0 51
applicant with special reception needs BG кандидат със специални потребности за приемане CS žadatel se zvláštními potřebami při přijetí Definition(s) EL αιτών με ειδικές ανάγκες υποδοχής (EL); αιτητής με ειδικές ανάγκες υποδοχής (CY) A vulnerable person, in accordance with Art. 21 of Directive 2013/33/EU (Recast Reception Conditions Directive), who is in need of special guarantees in order to benefit from the rights and obligations provided for in this Directive. EN applicant with special reception needs Source(s) DE Antragsteller mit besonderen Bedürfnissen bei der Aufnahme ES solicitante con necesidades de acogida particulares ET taotleja, kes vajab vastuvõtu eritingimusi FI hakija, jolla on erityisiä vastaanottotarpeita FR demandeur ayant des besoins particuliers en matière d’accueil Art. 2(k) of Directive 2013/33/EU (Recast Reception Conditions Directive) Broader term(s) applicant for international protection vulnerable person GA iarratasóir a bhfuil sainriachtanais fáiltithe aige Related term(s) HR tražitelj međunarodne zaštite s posebnim prihvatnim potrebama EMN Asylum and Migration Classification applicant in need of special procedural guarantees HU különleges befogadási igényekkel rendelkező kérelmező 4.1 International protection IT richiedente protezione internazionale con esigenze di accoglienza particolari 2811 migration LT specialių priėmimo poreikių turintis prašytojas LV pieteikuma iesniedzējs ar īpašām uzņemšanas vajadzībām MT Applikant(a) bi bżonnijiet speċjali ta’ akkoljenza NL verzoeker met bijzondere opvangbehoeften PL wnioskodawca o szczególnych potrzebach w zakresie przyjmowania PT requerente com necessidades de acolhimento especiais RO solicitant cu nevoi speciale de primire SK žiadateľ s osobitnými potrebami pri prijímaní (EU acquis) SL prosilec s posebnimi potrebami glede sprejema SV sökande med särskilda mottagandebehov NO søker som har behov for særskilte innkvarteringsforhold (b); søkjar som treng særskilde innkvarteringstilhøve (n) KA მიღების განსაკუთრებული საჭიროებების მქონე განმცხადებელი UK заявник з особливими потребами щодо прийому HY 52 ընդունելության հատուկ կարիքներ ունեցող դիմորդ EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Euro Voc Classification
A B application for asylum BG молба за убежище CS žádost o azyl EL αίτηση ασύλου EN application for asylum ES solicitud de asilo An application made by a foreigner or a stateless person which can be understood as a request for protection under the Geneva Refugee Convention and Protocol or national refugee law. E Source(s) G FI turvapaikkahakemus Derived by EMN from the definition in Art. 2 (b) of Council Directive 2005/85/EC (Asylum Procedures Directive) FR demande d’asile Synonym(s) ET varjupaigataotlus HR zahtjev za azil asylum application asylum claim HU menedékjog iránti kérelem Broader term(s) GA iarratas ar thearmann J K unfounded application for international protection LV patvēruma pieteikums L EMN Asylum and Migration Classification MT Talba / Applikazzjoni għall-ażil 4.1.1 Refugee protection NL asielverzoek / asielaanvraag M Euro Voc Classification PL wniosek o azyl PT pedido de asilo RO cerere de azil SK žiadosť o udelenie azylu / žiadosť o azyl SL prošnja za azil SV asylansökan NO asylsøknad KA განცხადება თავშესაფრის მოთხოვნის შესახებ ապաստանի դիմում I Narrower term(s) LT prašymas suteikti prieglobstį F H application for international protection IT domanda d’asilo HY D Definition(s) DE Asylantrag UK заява про надання притулку C 1231 international law| 2811 migration N Note(s) O 1. In most EU Member States this term is understood as a synonym to application for international protection following the adoption of Directive 2011/95/EU (Recast Qualification Directive) and Directive 2013/32/EU (Recast Asylum Procedures Directive). However, IE, which has not adopted the single procedure, continues to use the term ‘application for asylum’ for an application for protection under the Geneva Refugee Convention only. In DE the term is still used to include, in addition to the application for international protection according the Qualification Directive, also the application according to the national legislation, Art. 16a Basic Law. 2. Outside EU legislation and in everyday use, the terms ‘asylum application’ and ‘application for asylum’ are often used more frequently than ‘application for international protection’. 3. According to Protocol 24 of TFEU on asylum for nationals of Member States of the European Union (1997), EU Member States shall be regarded as constituting safe countries of origin in respect of each other for all legal and practical purposes in relation to asylum matters. Accordingly, any application for asylum made by a national of an EU Member State is normally not taken into consideration. In practice, non-EU Member States can receive applications for asylum from EU Member States. P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 53
application for international protection BG молба за международна закрила CS žádost o mezinárodní ochranu DE Antrag auf internationalen Schutz EL αίτηση για διεθνή προστασία EN application for international protection ES solicitud de protección internacional ET rahvusvahelise kaitse taotlus FI kansainvälistä suojelua koskeva hakemus FR demande de protection internationale GA iarratas ar chosaint idirnáisiúnta HR zahtjev za međunarodnu zaštitu Definition(s) A request made by a third-country national or a stateless person for protection from a EU Member State, that can be understood to seek refugee status or subsidiary protection status, and that does not explicitly request another kind of protection, outside the scope of Directive 2011/95/EU (Recast Qualification Directive), that can be applied for separately. Source(s) Art. 2(h) of Directive 2011/95/EU (Recast Qualification Directive) Narrower term(s) LV starptautiskās aizsardzības pieteikums application for asylum examination of an application for international protection subsequent application for international protection unfounded application for international protection withdrawal of an application for international protection MT Applikazzjoni / Talba għall-protezzjoni internazzjonali EMN Asylum and Migration Classification HU nemzetközi védelem iránti kérelem IT domanda di protezione internazionale LT tarptautinės apsaugos prašymas (EU acquis); prašymas suteikti prieglobstį NL verzoek om internationale bescherming PL wniosek o udzielenie ochrony międzynarodowej PT pedido de proteção internacional RO cerere de protectie internationala SK žiadosť o medzinárodnú ochranu (EU acquis) SL prošnja za mednarodno zaščito SV ansökan om internationellt skydd NO søknad om internasjonal beskyttelse (b); søknad om internasjonalt vern (n) KA განცხადება საერთაშორისო დაცვის მოთხოვნის შესახებ UK заява про надання міжнародного захисту HY 54 միջազգային պաշտպանության դիմում EMN ASYLUM AND MIGRATION GLOSSARY 10.0 4.1 International protection Euro Voc Classification 12 Law| 2811 migration Note(s) 1. In most EU Member States this term is understood as a synonym to ‘application for asylum’ following the adoption of Directive 2011/95/EU (Recast Qualification Directive) and Directive 2013/32/EU (Recast Asylum Procedures Directive). 2. In everyday use, the terms ‘asylum application’ and ‘application for asylum’ are often used more frequently than ‘application for international protection’. 3. According to Protocol 24 of TFEU on asylum for nationals of Member States of the European Union (1997), EU Member States shall be regarded as constituting safe countries of origin in respect of each other for all legal and practical purposes in relation to asylum matters. Accordingly, any application for asylum made by a national of an EU Member State is normally not taken into consideration.
A B apprehension BG задържане CS zadržení DE Aufgriff / Ergreifung / Festnahme EL σύλληψη EN apprehension ES aprehensión ET kinnipidamine / vahistamine FI kiinniottaminen FR arrestation; appréhension (BE, LU) GA gabháil HR zatjecanje HU elfogás / feltartóztatás IT arresto C D Definition(s) In the EU migration context, any action by the relevant national authority(ies) which results in identifying an irregular migrant and which may limit the freedom of movement of the person concerned. E Source(s) G Related term(s) H EMN Asylum and Migration Classification I Euro Voc Classification J Developed by EMN irregular migrant 13. Irregular Migration 2811 migration K LT sulaikymas L LV aizturēšana personas identitātes noskaidrošanai MT Qbid / Arrest M NL aanhouding PL zatrzymanie N PT detecção RO luare in custodie publica O SK zadržanie (EU acquis); predvedenie SL prijetje P SV kvarhållande NO pågripelse (b); pågriping (n) Q KA დაკავება R UK затримання HY F ձերբակալություն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 55
arranged marriage BG уреден брак CS dohodnutý sňatek DE arrangierte Ehe / arrangierte Eheschließung EL προσυμφωνημένος γάμος EN arranged marriage ES matrimonio arreglado / matrimonio concertado ET korraldatud abielu FI järjestetty avioliitto FR mariage arrangé GA cleamhnas Definition(s) Marriage in which the marital partners are proposed or selected by individuals other than the couple themselves. Source(s) Derived by EMN from the entry of ‘arranged marriage’ in the IATE terminology database Related term(s) forced marriage EMN Asylum and Migration Classification HR dogovoreni brak 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) HU elrendezett házasság Euro Voc Classification IT matrimonio combinato 2806 family LT primestoji santuoka LV sarunātas laulības MT żwieġ arranġat NL gearrangeerd huwelijk PL małżeństwo aranżowane PT casamento arranjado RO căsătorie aranjată SK dohodnuté manželstvo SL dogovorjena poroka / dogovorjena zakonska zveza SV arrangerat äktenskap NO arrangert ekteskap KA გარიგებით ქორწინება UK фіктивний шлюб HY 56 համաձայնեցված ամուսնություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Note(s) 1. Arranged marriages are different from forced marriages. One difference with forced marriage is the element of choice in accepting or refusing the arrangement. However, the distinction of forced and arranged marriage is not clear-cut, as it is difficult to assess when the spouses have or have not been under pressure to consent to marry. One or both partners may be subjected to cultural pressures, which may in fact result in limiting the free will to contract marriage. And if at least one of the parties does not consent to the marriage, an arranged marriage becomes a forced marriage. 2. For more information see: FRA: Addressing forced marriage inthe EU: legal provisions and promising practice, 2014 and European Parliament: forced marriages from a gender perspective, 2016.
A B Asia-Europe Meeting (ASEM) BG Среща Азия-Европа CS Asijsko-evropské setkání DE Asien-Europa-Treffen EL Ευρωασιατικές Συναντήσεις EN Asia-Europe Meeting (ASEM) ES Conferencia Asia-Europa ET Aasia-Euroopa kohtumine FI Aasian ja Euroopan yhteistyöfoorumi FR Réunion Asie-Europe GA Cruinniú den Áis agus den Eoraip HR Azijsko-europski sastanak HU Ázsia-Európa Találkozó IT Meeting Asia-Europa LT Azijos ir Europos susitikimas LV Āzijas un Eiropas sanāksme MT Laqgħa (Il-) Asja-Ewropa NL Asia-Europe Meeting PL Asia-Europe Meeting C D Definition(s) An informal process of dialogue and cooperation bringing together countries of the two regions (27 EU Member States, two other European countries and 20 Asian countries), the European Commission and the Association of Southeast Asian Nations (ASEAN) Secretariat which addresses political, economic and cultural issues, with the objective of strengthening the relationship between the two regions, in a spirit of mutual respect and equal partnership. E Source(s) I Synonym(s) J Related term(s) K EMN Asylum and Migration Classification L Euro Voc Classification M F G H Website of the Asia-Europe-Meeting (ASEM) ASEM Global Approach to Migration and Mobility (GAMM) 15.1 EU External dimension of migration and mobility 2811 migration| 7616 extra-European Organisations N PT Cimeira Ásia-Europa RO Reuniunea Asia Europa SK Stretnutie Ázia - Európa (EU acquis); Fórum Ázia - Európa (ASEM) SL Azijsko-evropsko srečanje SV Asia-Europe Meeting / Asien-Europa-mötet Note(s) 1. ASEM was initiated in 1996 in Bangkok. 2. In the political field, areas of common interest include the fight against terrorism or the management of migration flows; discussions on human rights, on the protection of children, and on the impact of globalisation. 3. For more information, see the website of the Asia-Europe meeting. P Q NO Asia-Europe Meeting KA აზია-ევროპის დიალოგი (ASEM) R UK Форум «Азія-Європа» (АСЕМ) HY O S Եվրոպա-Ասիա հանդիպում T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 57
assigned area of residence BG Зададена област на пребиваване CS vymezené území DE zugewiesenes Wohngebiet / geographische Beschränkung des Aufenthalts / Wohnsitzauflage / Wohnsitzbeschränkung EL οριζόμενη περιοχή διαμονής Definition(s) Assignment of applicants for international protection and/or beneficiaries of international protection to a particular area of residence. Source(s) EN assigned area of residence Derived by EMN from Art. 7(2) of Directive 2013/33/EU (Recast Reception Conditions Directive) ES zona asignada Synonym(s) ET kindlaksmääratud elamispiirkond FI osoitettu asuinpaikka FR zone de résidence assignée GA HR određeno područje boravka HU kijelölt tartózkodási hely IT area o luogo di residenza assegnata LT nustatyta gyvenamoji vieta LV noteiktais dzīvesvietas apgabals geographic restriction on residence obligatory residence residence condition residence obligation residence rule EMN Asylum and Migration Classification 4.4 Reception and Accommodation of Applicants for international protection and other refugees Euro Voc Classification 2811 migration MT Distrett / Żona residenzjali assenjat/a NL aangewezen / toegewezen gebied van verblijf PL wyznaczony obszar PT área de residência designada RO zona stabilită SK určená oblasť pobytu SL določeno območje prebivanja SV anvisat boendeområde NO Pålagt bosted (b); Pålagd bustad (n) KA გამოყოფილი საცხოვრისი UK призначена територія проживання HY 58 նշանակված բնակության շրջան EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Note(s) 1. According to Art. 7(2) of Directive 2013/33/EU (Recast Reception Conditions Directive) applicants for international protection may be assigned to a specific area for reasons of public interest, public order or, when necessary, for the swift processing and effective monitoring of their application for international protection. They may move freely within this assigned area. The assigned area shall not affect the unalienable sphere of private life and shall allow sufficient scope for guaranteeing access to all benefits under this Directive. 2. National laws and/or administrative regulations of EU Member States and NO may determine where beneficiaries of international protection will live, by either allocating them to or banning them from certain areas. The objective is to facilitate integration. 3. According to Art. 33 of Directive 2011/95/EU (Recast Qualification Directive) EU Member States must allow freedom of movement within their territory to beneficiaries of international protection under the same conditions as those provided for other non-EU citizens who are legally resident. Beneficiaries of subsidiary protection may be required to reside at a specific area of residence only in limited cases as the CJEU held in its judgment of 1 March 2016 (joined cases C-443/14 and C-444/14 ‹Alo & Osso›). In line with that judgment, EU law does not preclude EU Member States from imposing residence conditions on a beneficiary of subsidiary protection status in receipt of certain specific social security benefits, with the objective of facilitating the integration of third-country nationals in the EU Member State that has granted that protection. However, such a limitation is not for the purpose of achieving an appropriate distribution of the burden of paying benefits among the various institutions competent in that regard, when the applicable national rules do not provide for the imposition of such a measure for other groups of migrants (including refugees). For more information see CJEU judgment of 1 March 2016. 4. The concept of an assigned area of residence may be implemented in the national context of EU Member States in different ways and be applied to different categories of applicants and/or beneficiaries of international protection. In IT beneficiaries of international protection can be assigned to a specific address/place of residence.
A B assimilation BG асимилация CS asimilace DE Assimilation EL αφομοίωση EN assimilation ES asimilación C The gradual process by which a minority group adopts the patterns of behaviour of a majority group or host society and is eventually absorbed by the majority group / host society. E Source(s) G ET assimileeruma Malgesini and Giménez: Guía de conceptos sobre migraciones racismo e inteculturalidad, 2000 FI assimilaatio Synonym(s) FR assimilation GA asamhlú HR asimilacija HU asszimiláció IT assimilazione D Definition(s) F H cultural assimilation I Broader term(s) acculturation J EMN Asylum and Migration Classification LT asimiliacija 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) K LV asimilācija Euro Voc Classification L MT Assimilazzjoni 2811 migration| 2816 demography and population M NL assimilatie PL asymilacja N PT assimilação RO asimilare O SK asimilácia SL asimilacija P SV assimilering NO assimilering Q KA ასიმილაცია R UK асиміляція HY ասիմիլյացիա (ձուլում) S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 59
assisted voluntary return BG подпомогнато / асистирано доброволно връщане CS asistovaný dobrovolný návrat Definition(s) DE unterstützte freiwillige Rückkehr Voluntary return or voluntary departure supported by logistical, financial and / or other material assistance. EL υποβοηθούμενη εκούσια / εθελούσια επιστροφή Source(s) EN assisted voluntary return Developed by EMN ES retorno voluntario asistido Broader term(s) FI avustettu vapaaehtoinen paluu voluntary departure voluntary return FR aide au retour volontaire EMN Asylum and Migration Classification ET toetatud vabatahtlik tagasipöördumine GA cur ar ais deonach cuidithe HR potpomognuti dragovoljni povratak HU támogatott önkéntes visszatérés IT rimpatrio volontario assistito LT (remiamas) savanoriškas grįžimas LV atbalstīta brīvprātīga atgriešanās MT Ritorn volontarju assistit NL begeleide vrijwillige terugkeer PL wspomagany dobrowolny powrót PT programa de retorno voluntário assistido e reintegração (ARVoRe) RO returnare voluntară asistată SK asistovaný dobrovoľný návrat (ADN / AVR) SL prostovoljno vračanje s pomočjo SV frivilligt återvändande NO assistert retur KA ნებაყოფლობითი დაბრუნების ხელშეწყობა UK сприяння добровільному поверненню HY 60 աջակցվող կամավոր վերադարձ EMN ASYLUM AND MIGRATION GLOSSARY 10.0 12.1 Voluntary return Euro Voc Classification 2811 migration
assisted voluntary return and reintegration programme (AVRR) BG програма за подпомагане на доброволното връщане и реинтеграция (ПАДВР) CS asistovaný dobrovolný návrat a reintegrační program ES programa de retorno voluntario ET toetatud vabatahtliku tagasipöördumise ja reintegratsiooni programm FI avustetun vapaaehtoisen paluun ja uudelleenkotoutumisen ohjelma FR programme d’aide au retour volontaire et à la réintégration (AVRR) (BE, LU); programme d’aide au retour volontaire et à la réinsertion (AVRR) (FR) GA clár fillte HR Program potpomognutog dragovoljnog povratka i reintegracije HU támogatott önkéntes visszatérési és reintegrációs program IT programma di ritorno volontario assistito con reintegrazione (RVA&R) LT (remiamo) savanoriško grįžimo ir reintegracijos programa LV atbalstītas brīvprātīgās atgriešanās un reintegrācijas programma MT Programm t’assistenza / ta’ għajnuna għal ritorn volontarju u riintegrazzjoni (PARVR) NL terugkeerprogramma PL program wspomaganych dobrowolnych powrotów i reintegracji PT Programa de apoio ao retorno voluntário e à reintegração RO program de returnare voluntară și reintegrare asistată (AVRR) SK program asistovaných dobrovoľných návratov a reintegrácií (AVRR) SL program pomoči pri prostovoljnem vračanju in ponovnem vključevanju SV program för stöd till frivilligt återvändande och återintegrering NO Assistert retur- og reintegreringsprogram (AVVR), tidligere Returprogram KA ნებაყოფლობითი დაბრუნებისა და რეინტეგრაციის ხელშეწყობის პროგრამა (AVRR) UK Програма допомоги в добровільному поверненні та реінтеграції (AVRR) HY աջակցվող կամավոր վերադարձի և B C D Definition(s) DE Programm zur Unterstützung der freiwilligen Rückkehr und Reintegration EL πρόγραμμα επιστροφής EN assisted voluntary return and reintegration programme (AVRR) A Any measure to support (e.g. administrative, financial, logistical, counselling) the return and reintegration of a returnee in their country of origin or another third country by the State or by a third party (e.g. an international organisation or non-governmental organisation) which enable the returnee to lead an independent life in the country of return. E Source(s) H F G EMN: Guidelines for monitoring and evaluation of AVR(R) programmes, January 2016 Derived by EMN from IOM Glossary on Migration, 2019 Synonym(s) AVR assisted voluntary return and reintegration AVR assisted voluntary return and reintegration package AVVR return programme Broader term(s) I J K L M assisted voluntary return return counselling sustainable return N EMN Asylum and Migration Classification O 12.1 Voluntary return Euro Voc Classification 2811 migration P Note(s) Q 1. Assisted voluntary return and reintegration programmes (AVRR) are an indispensable part of a comprehensive approach to migration management aiming at orderly and humane return and reintegration of migrants (rejected applicants for international protection, victims of trafficking in human beings, stranded migrants) who are unable or unwilling to remain in host or transit countries and wish to return voluntarily to their countries of origin. The programmes should not only take into account the Needs of the individual returnee but also address the Needs of local communities in the Country of origin. 2. The successful implementation of AVRR programmes requires the cooperation and participation of a broad range of actors, including the migrants, civil society and the governments in both host and transit countries and countries of origin. For further information see the IOM-Website on Assisted Voluntary Return and Reintegration. 3. EU return policy favours voluntary departure over forced return. As third-country nationals often lack the financial means to leave voluntarily, EU Member States have developed AVR(R) programmes to facilitate their voluntary departure. The form and nature of the assistance provided differs between EU Member States and not all EU Member States provide reintegration assistance. 4. An example for a joint reintegration programme is the European Reintegration Network (ERIN) Specific Action Program co-funded by the European Asylum, Migration and Integration Fund (AMIF) and by the partner countries. It aims to implement sustainable return and reintegration of third country nationals in their country of origin, with cooperation between ERIN partner institutions from the participating host countries. For further information see the webpages of the partner countries of ERIN as e.g. for Belgium. վերաինտեգրման ծրագիր EMN ASYLUM AND MIGRATION GLOSSARY 10.0 61 R S T U V W X Y Z
asylum BG убежище CS azyl DE Asyl EL άσυλο EN asylum ES asilo ET varjupaik FI turvapaikka FR asile GA tearmann HR azil HU menedékjog IT asilo LT prieglobstis LV patvērums MT Ażil NL asiel PL azyl PT asilo RO azil SK azyl SL azil SV asyl NO asyl KA თავშესაფარი UK притулок HY 62 ապաստան EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Definition(s) A form of protection given by a State on its territory, based on the principle of non-refoulement and internationally or nationally recognised refugee rights and which is granted to a person who is unable to seek protection in their country of citizenship and / or residence, in particular for fear of being persecuted for reasons of race, religion, nationality, membership of a particular social group or political opinion. Source(s) Developed by EMN Narrower term(s) right to asylum Related term(s) international protection EMN Asylum and Migration Classification 4.2.1 Constitutional Asylum Euro Voc Classification 2811 migration Note(s) The literal translation of this term in Bulgarian (the word ‘убежище’) refers to a specific kind of protection which is granted by the President of the Republic of Bulgaria and differs from the protection granted on the basis of the Geneva Refugee Convention and Protocol.
Asylum and Migration Management Regulation BG Регламент за управление на убежището и миграцията ES Reglamento de la gestión del Asilo y la Migración ET Varjupaiga ja rändehalduse määrus Source(s) DE Verordnung über Asyl- und Migrationsmanagement EL Κανονισμός για τη διαχείριση του ασύλου και της μετανάστευσης EN Asylum and Migration Management Regulation FI Asetus turvapaikka-asioiden ja muuttoliikkeen hallinnasta FR Règlement relatif à la gestion de l’asile et de la migration GA an Rialachán maidir le Bainistiú Tearmainn agus Imirce HR Uredba o upravljanju azilom i migracijama HU Menekültügyi és migrációkezelési rendelet IT Regolamento sulla gestione dell’asilo e della migrazione LT Prieglobsčio ir migracijos valdymo reglamentas LV Patvēruma un migrācijas pārvaldības regula MT Regolament li Jistabbilixxi l-iMmaniġġjar tal-Ażil u l-Migrazzjoni B C D Definition(s) Proposed regulation aiming to replace the current Dublin Regulation and to relaunch the reform of the Common European Asylum System (CEAS) by setting out a common framework for the management of asylum and migration in the EU including a solidarity mechanism based on the principle that responsibility should be assumed by the EU as a whole rather than by individual EU Member States. CS Nařízení o řízení azylu a migrace A E F G H I Derived by EMN from IATE based on the Proposal for a Regulation on Asylum and Migration Management J Broader term(s) asylum migration K Related term(s) L EMN Asylum and Migration Classification M Common European Asylum System (CEAS) 2.2 EU (e.g. Common European Asylum System, Qualification Directive, European Agenda for Migration)| 4.1 International protection N Euro Voc Classification O 1011 European Union law| 2811 migration NL Verordening betreffende asiel- en migratiebeheer P PL Rozporządzenie ws. Zarządzania Azylem i Migracją Q PT Regulamento Gestão do Asilo e da Migração RO Regulamentul privind gestionarea azilului și migrației R SK nariadenie o riadení azylu a migrácie SL Uredba o upravljanju azila in migracij SV förordningen om asyl- och migrationshantering S NO Forordningen om asyl- og migrasjonshåndtering (b); Forordninga om asyl- og migrasjonshandtering (n) T KA თავშესაფრისა და მიგრაციის მართვის U რეგულაცია UK Положення про надання притулку та управління міграцією V HY W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 63
asylum seeker BG търсещ убежище CS žadatel o azyl DE Asylbewerber (EU acquis, DE); Asylwerber (AT); Asylantragsteller (LU) EL αναζητών άσυλο (EL); αιτητής ασύλου (CY) EN asylum seeker ES solicitante de asilo ET varjupaigataotleja FI turvapaikanhakija FR demandeur d’asile GA iarratasóir ar thearmann Definition(s) In the global context, a person who seeks protection from persecution or serious harm in a country other than their own and awaits a decision on the application for refugee status under relevant international and national instruments. In the EU context, a third-country national or stateless person who has made an application for protection under the Geneva Refugee Convention and Protocol in respect of which a final decision has not yet been taken. Source(s) HU menedékkérő Global context: Developed by EMN EU context: Derived by EMN from Art. 2(b) of Council Directive 2005/85/EC (Asylum Procedures Directive) IT richiedente asilo Synonym(s) HR tražitelj azila LT prieglobsčio prašytojas LV patvēruma meklētājs asylum applicant Broader term(s) MT Applikant(a) għall-ażil applicant for international protection NL asielzoeker Related term(s) PL osoba ubiegająca się o nadanie statusu uchodźcy (azyl) refugee PT requerente de asilo 4.1.1 Refugee protection RO solicitant de azil SK žiadateľ o udelenie azylu / žiadateľ o azyl EMN Asylum and Migration Classification Euro Voc Classification 2811 migration SL prosilec za azil SV asylsökande NO asylsøker (b); asylsøkjar (n) KA თავშესაფრის მაძიებელი UK шукач притулку HY 64 ապաստան հայցող EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Note(s) 1. In most EU Member States this term is understood as a synonym to applicant for international protection following the adoption of Directive 2011/95/EU (Recast Qualification Directive) and Directive 2013/32/EU (Recast Asylum Procedures Directive). However, IE which has not adopted the single procedure, continues to use the term ‘asylum seeker’ for an applicant who requests protection under the Geneva Refugee Convention and Protocol only. In DE the term is still used to include, in addition to the provisions of Directive 2011/95/EU, those of the national legislation, Art. 16a Basic Law. 2. Outside EU legislation, the terms ‘asylum seeker’ or ‘asylum applicant’ are often used more frequently than ‘applicant for international protection’ in the everyday use of the term.
A B asylum shopping C BG пазаруване на убежище CS spekulativní podávání žádostí o azyl DE Asyl-Shopping EL τo φαινόμενo της αναζήτησης του ευνοϊκότερου κράτους υποδοχής από τους αιτούντες άσυλο / asylum shopping EN asylum shopping ES compra de asilo ET soodsaima varjupaigariigi valimine FI turvapaikkashoppailu (halv.) FR no usual translation GA siopadóireacht tearmainn HR no usual translation HU no usual translation IT shopping delle richieste di asilo LT ieškojimas, kur geriau gauti prieglobstį LV izdevīgāko patvēruma noteikumu meklēšana MT Sajda għall-ażil NL asielshoppen PL asylum shopping / no usual translation PT asylum shopping RO introducere de cereri multiple de azil / asylum shopping SK zneužívanie azylového systému / azylový turizmus SL izbiranje države azila / izbiranje najugodnejše azilne ureditve SV asylum shopping (ansökningar om asyl i flera länder samtidigt) / asylshopping NO asylshopping KA თავშესაფრის უფლებით ვაჭრობა UK пошук притулку в різних країнах HY D Definition(s) E In the context of the Dublin Regulation, the phenomenon where a third-country national applies for international protection in more than one EU Member State with or without having already received international protection in one of those EU Member States. F G Source(s) Derived by EMN from Commission Staff Working Document SEC/2008/2029 accompanying the European Commission Communication on the policy plan on asylum, COM(2008) 360 final H Broader term(s) J Related term(s) K EMN Asylum and Migration Classification L Euro Voc Classification M secondary movement of migrants Dublin Regulation 4.1 International protection 2811 migration I N Note(s) 1. The term ‘asylum-shopping’ has no legal definition, but is used in an informal sense and also in Commission Communications. It is often used with a negative connotation, as it implies an abuse of the asylum procedure through the lodging of more than one application for international protection in different EU Member States (choosing the EU Member State which may grant the most appealing social, humanitarian and economic standards). 2. A second meaning understands asylum shopping as a comparison and selection of one asylum rule among several (see European University Institute: the Development of the EU Asylum Policy: Revisiting the Venue-shopping Argument). 3. Commission Staff Working Document SEC/2008/2029 provides not only some examples of what ‹asylum shopping› means but also an assessment of the impacts of the Dublin system (which comprises the Regulation (EU) No 604/2013 (Dublin III Regulation) and Regulation (EU) No 603/2013 (Eurodac Regulation) and their implementing regulations). O P Q R S T ապաստանի ընթացակարգի չարաշահում U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 65
Asylum, Migration and Integration Fund (AMIF) BG Фонд “Убежище, миграция и интеграция” CS Azylový, migrační a integrační fond DE Asyl-, Migrations- und Integrationsfonds EL Ταμείο Ασύλου, Μετανάστευσης και Ένταξης / ΤΑΜΕ EN Asylum, Migration and Integration Fund (AMIF) ES Fondo de Asilo, Migración e Integración (FAMI) ET Varjupaiga-, Rände- ja Integratsioonifond Definition(s) An EU financial instrument which supports national and EU initiatives that promote the efficient management of migration flows and the implementation, strengthening and development of a common Union approach to asylum, migration and integration. Source(s) FI Turvapaikka-, maahanmuutto- ja kotouttamisrahasto Derived by EMN from Art. 3 of Regulation (EU) No 516/2014 (AMIF-Regulation) FR Fonds Asile, migration et intégration (FAMI) Synonym(s) GA An Ciste um Thearmann, Imirce agus Lánpháirtíocht AMIF HR Fond za azil, migracije i integraciju (AMIF) EMN Asylum and Migration Classification HU Menekültügyi, Migrációs és Integrációs Alap (MMIA) IT Fondo Asilo, Migrazioni e Integrazione / FAMI LT Prieglobsčio, migracijos ir integracijos fondas / PMIF LV Patvēruma, migrācijas un integrācijas fonds MT Fond għall-Ażil, Migrazzjoni u Integrazzjoni NL Fonds voor Asiel, Migratie en Integratie / Asiel-, Migratie- en Integratiefonds PL fundusz Azylu, Migracji i Integracji (FAMI) PT Fundo para o asilo, a migração e a integração (FAMI) RO Fondul pentru azil, migrație și integrare (FAMI) SK Fond pre azyl, migráciu a integráciu (AMIF) SL Sklad za azil, migracije in vključevanje SV Asyl-, migrations- och integrationsfonden NO Asylum, Migration and Integration Fund (no usual translation) KA თავშესაფრის, მიგრაციისა და ინტეგრაციის ფონდი (AMIF) UK Фонд притулку, міграції та інтеграції (ФПМІ) HY 66 Ապաստանի, Ներգաղթի (Միգրացիայի) եւ Ինտեգրման Հիմնադրամ (Ֆոնդ) EMN ASYLUM AND MIGRATION GLOSSARY 10.0 14.2 Economic factors and impacts (such as brain drain/ gain, employment/ unemployment, labour market, economic growth, dumping) Euro Voc Classification 2811 migration Note(s) 1. AMIF was set up by the European Commission, DG Migration and Home Affairs in 2014 and is governed by the Common Provisions Regulation. It aims to contribute to the achievement of the following four specific objectives: ƒ asylum: strengthening and developing the Common European Asylum System (CEAS); ƒ legal migration and integration: supporting legal migration to EU Member States in line with the labour market needs and the effective integration of non-EU nationals; ƒ return: enhancing fair and effective return strategies, which contribute to combating irregular migration, with an emphasis on sustainability and effectiveness of the return process; ƒ solidarity: making sure that EU Member States which are most affected by migration and asylum flows can count on solidarity from other EU Member States, while fully respecting the rights and principles enshrined in the Charter of Fundamental Rights of the European Union. 2. The Fund also provides financial resources for the activities of the European Migration Network (EMN). 3. For further information see the AMIF-Website of DG Migration and Home Affairs.
A B au pair BG детегледачка CS au pair DE Au-pair EL εσωτερικός άμισθος βοηθός / au pair EN au pair ES au pair ET au pair lapsehoidja C A third-country national who is admitted to the territory of an EU Member State to be temporarily received by a family in order to improve their linguistic skills and knowledge of the host country in exchange for light housework and taking care of children. Source(s) FI au pair Art. 3 (8) of Directive (EU) 2016/801 (Recast Researchers and Students Directive) FR au pair EMN Asylum and Migration Classification GA au pair 3.3 Migration for Study and Research HR au pair Euro Voc Classification HU au pair D Definition(s) F G H I J 1011 European Union law| 3206 education IT persona collocata alla pari K LT au pair auklė L LV viesaukle MT au pair M NL au pair PL au pair N PT au pair RO lucrator au pair O SK au pair / au-pair SL au pair P SV au pair NO au pair Q KA ოჯახში დამხმარე R UK особа, що працює за програмою «au pair» HY E տնային օգնական / au pair S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 67
Automated Border Control (ABC) BG Автоматизиран граничен контрол CS Automatizovaná hraniční kontrola DE automatische Grenzkontrolle EL Αυτόματα συστήματα συνοριακού ελέγχου EN Automated Border Control (ABC) ES Control automatizado de fronteras ET Automatiseeritud piirikontroll FI automaattinen rajavalvonta FR contrôle automatisé aux frontières Definition(s) A system which allows for an automated border passage by authenticating an electronic machine readable travel document (e-MRTD), establishing that the passenger is the rightful holder of the document, quering border control records and automatically determining eligibility for border crossing according to pre-defined rules and which is composed of a self-service system and an e-gate. Source(s) HR automatizirana granična kontrola Derived by EMN from Frontex: Best Practice Operational Guidelines for Automated Border Control (ABC) Systems. - Version 2, 2012 HU Automatizált Határellenőrzés Synonym(s) GA Rialú Uathoibrithe Teorann IT Controllo automatizzato delle frontiere LT Automatizuota pasienio kontrolė LV automatizētā robežkontrole MT Sistema Awtomatizzata ta’ Kontroll mal-Konfini / mal-Fruntieri NL geautomatiseerde grenspassage (NL) / grenscontrole (NL, BE) PL Automatyczna Kontrola Graniczna ABC automated border control system ePassport eMRTD Broader term(s) border control Narrower term(s) PT Controlo Automático de Fronteiras e-gate self-service system RO sistem de control automat la frontieră (ABC) EMN Asylum and Migration Classification SK automatizovaná hraničná kontrola (ABC) 6.1.1 Border control SL avtomatska mejna kontrola Euro Voc Classification SV automatisk gränskontroll NO automatisert grensekontroll KA ავტომატიზებული სასაზღვრო კონტროლი (ABC) UK Автоматизований прикордонний контроль (АПК) HY 68 սահմանային ավտոմատացված հսկողություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0 2811 migration Note(s) 1. ‘Self-service system’ means an automated system which performs all or some of the border checks that are applicable to a person. ‘E-gate’ means an infrastructure operated by electronic means where the effective crossing of an external border takes place (Art. 1 of a Proposal for a Regulation amending Regulation (EU) 2016/399 as regards the use of the Entry/Exit System). 2. Many Schengen countries have installed ABC in their major airports, making traffic flow more effective. People who travel with an ePassport can pass through an ABC portal, where the passport is read. The traveller’s biometry is compared with the information contained in the passport, and if these correspond they may pass the border.
Automated Fingerprint Identification System (AFIS) BG Автоматизирана система за идентификация на пръстови отпечатъци EL Αυτόματο Σύστημα Αναγνώρισης Δακτυλικών Αποτυπωμάτων (AFIS) (EL); Αυτοματοποιημένο Σύστημα Αναγνώρισης Δακτυλικών Αποτυπωμάτων (AFIS) (CY) F G Source(s) Tech Target website: Definition of Automated Fingerprint Identification System EN Automated Fingerprint Identification System (AFIS) Synonym(s) ES Sistema automatizado de identificación de huellas digitales J Broader term(s) FI automaattinen sormenjälkien tunnistusjärjestelmä Eurodac FR Système automatisé d’identification des empreintes digitales K EMN Asylum and Migration Classification HR sustav za automatiziranu identifikaciju otisaka prstiju (AFIS) 6.3 Specific aspects of migration procedures| 6.3.2. Establishment of identity of applicants for international protection (incl. examination of documents, language analysis, age assessment) HU Automatizált Ujjnyomat-azonosító Rendszer Euro Voc Classification GA Uathchóras Aithinte ó Mhéarloirg: UCAM IT Sistema automatizzato di identificazione delle impronte digitali LT Automatinė pirštų atspaudų indentifikavimo sistema L M 2811 migration N Note(s) O The Eurodac database which is based on AFIS does not contain details such as the name of a person because it relies only on biometric comparison, the safest and most accurate available identification method. LV automatizētā pirkstu nospiedumu identifikācijas sistēma H I AFIS Automated Fingerprint Identification System ET Automaatne sõrmejälgede tuvastamise süsteem C E Biometric identification methodology that uses digital imaging technology to obtain, store, and analyse fingerprint data, and which is used within the Eurodac system for the automatic recognition and checking of fingerprints. DE automatisiertes Fingerabdruckidentifizierungssystem B D Definition(s) CS Automatizovaný systém identifikace podle otisků prstů A MT Sistema Awtomatizzata għall-Identifikazzjoni tal-Marki tas-Swaba’ P Q NL Geautomatiseerde vingerafdrukidentificatiesysteem PL Automatyczny System Identyfikacji Daktyloskopijnej R PT Sistema Automático de Identificação de Impressões Digitais S RO Sistem automat de identificare a amprentelor digitale SK automatizovaný systém daktyloskopickej identifikácie (AFIS) T SL sistem za avtomatsko primerjavo prstnih odtisov U SV automatiskt fingeravtrycksidentifieringssystem / Afis V NO automatisert system for gjenkjennelse av fingeravtrykk (b); automatisert system for attkjenning av fingeravtrykk (n) W KA თითის ანაბეჭდებით იდენტიფიცირების ავტომატიზებული სისტემა (AFIS) X UK Автоматизована система ідентифікації відбитків пальців (АСІВП) HY Y ավտոմատացված մատնահետքի նույնականացման էլեկտրոնային համակարգ EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Z 69
awareness raising campaign on the risk of irregular migration BG кампания за повишаване на осведомеността относно риска от незаконна миграция LV izpratnes veicināšanas kampaņa par neatbilstīgas migrācijas riskiem CS kampaň na zvýšení povědomí o riziku neregulérní migrace MT DE Sensibilisierungskampagne über das Risiko von irregulärer Migration / Sensibilisierungs- und Informationskampagne über irreguläre Migration EL εκστρατεία ευαισθητοποίησης σχετικά με τον κίνδυνο παράτυπης μετανάστευσης EN awareness raising campaign on the risk of irregular migration ES campaña de información sobre el riesgo de migración irregular NL bewustmakingscampagne over het risico van illegale migratie PL kampanie podnoszące świadomość w zakresie ryzyka nieregularnej migracji PT campanha de sensibilização sobre o risco de migração irregular RO campanie de creştere a gradului de conştientizare privind riscul migrației iregulare / campanie de sensibilizare cu privire la riscul de migrație iregulare ET teadlikkuse tõstmise kampaania ebaseadusliku rändega kaasnevatest riskidest SK kampaň na zvyšovanie povedomia o rizikách neregulárnej migrácie / kampaň na zvyšovanie povedomia o rizikách nelegálnej migrácie FI tiedotuskampanja säännösten vastaisen maahanmuuton riskeistä SL kampanja ozaveščanja o tveganjih, povezanih z nedovoljenimi migracijami FR campagne de sensibilisation au risque lié à la migration irrégulière SV informationskampanj om risken med irreguljär migration GA feachtas feasachta ar riosca na himirce neamhrialta NO bevisstgjøringskampanje om risiko ved irregulær migrasjon (b); bevisstgjeringskampanje om risiko ved irregulær migrasjon (n) HR Kampanja podizanja svijesti o riziku kod nezakonitih migracija HU tudatosságnövelő kampány az illegális migráció kockázatáról IT campagna di sensibilizzazione sui rischi della migrazione irregolare LT informuotumo apie neteisėtos migracijos riziką didinimo kampanija 70 EMN ASYLUM AND MIGRATION GLOSSARY 10.0 KA საინფორმაციო კამპანია კანონიერი საფუძვლის გარეშე (არალეგალური) მიგრაციის რისკებთან დაკავშირებით UK кампанія з підвищення обізнаності щодо ризику нелегальної міграції HY անկանոն միգրացիայի ռիսկերի վերաբերյալ իրազեկման արշավ
A B C D Definition(s) E Deliberate efforts within a specific time period to inform or influence behaviours of (potential) migrants about the risks and complex realities of irregular migration using an organised set of communication activities. F G Source(s) Derived by EMN from the Study on best practices in irregular migration awareness campaigns, 2021. H Synonym(s) I awareness raising and information campaign on migration information and awareness raising campaign on the risk of irregular migration irregular migration awareness raising campaign J K EMN Asylum and Migration Classification L 13. Irregular Migration| 14.1 Political factors and impacts (such as political stability, political climate, public discourse, partly overlap with class 2) M Euro Voc Classification 2811 migration| 32 Education and Communications N Note(s) O 1. Rapid changes in migratory flows towards Europe in the past decade have solidified irregular migration as a priority on the political agenda in the European Union (EU) and most of its Member States. Awareness-raising campaigns on the risks of irregular migration have been among the many responses aimed at reducing irregular migration to Europe and to prevent the exploitation of migrants by criminal networks. The European Agenda on Migration (2015) and the New Pact on Migration and Asylum (2020) underlined the need to develop an EU strategic communication approach incorporating EU and EU Member States› awareness raising and information campaigns. 2. The information campaigns provide information on ƒ the risks of irregular migration during the journey and after arrival and ƒ the difficult circumstances of living irregularly in the country of destination. They intend to reduce the demand for and the risk of being smuggled and falling victim to human trafficking. They seek to ensure that (potential) migrants are enabled to make informed decisions. 3. Such campaigns are communicated through different channels and can take different forms, running from traditional communication tools such as posters, leaflets, advertisements in newspapers and television commercials to community meetings and workshops, public forums held in schools, and producing movies and comic books. P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 71
Bali Process BG Процесът Бали CS Balijský proces / Proces Bali DE Bali-Prozess EL Διαδικασία του Μπαλί EN Bali Process ES Proceso de Bali ET Bali protsess FI Balin prosessi Definition(s) An international forum dealing with smuggling of migrants and trafficking in human beings, participated in by over 50 countries in the Asia-Pacific region and beyond. Source(s) Website of the Bali Process Synonym(s) FR Processus de Bali Bali Process on People Smuggling, Trafficking in Persons and Related Transnational Crime GA Próiseas Bali Related term(s) HR Bali proces IT Processo di Bali Global Approach to Migration and Mobility (GAMM) smuggling of migrants trafficking in human beings LT Balio procesas EMN Asylum and Migration Classification HU Bali Folyamat LV Bali process MT Proċess (Il-) ta’ Bali NL Bali proces PL Proces Bali PT Processo de Bali RO Procesul Bali SK Balijský proces SL Balijski proces SV Baliprocessen NO Bali-prosessen KA ბალის პროცესი UK Балійський процес HY 72 Բալիի գործընթաց EMN ASYLUM AND MIGRATION GLOSSARY 10.0 13.1 Migrant smuggling| 13.2 Trafficking in human beings Euro Voc Classification 2811 migration Note(s) 1. The Bali Process was established through a framework agreement that was initiated at the Regional Ministerial Conference on People Smuggling, Trafficking in Persons and Related Transnational Crime’ held in Bali, Indonesia in February 2002. 2. It aims to facilitate discussion and information sharing about issues relating to people smuggling, human trafficking, and related transnational crime and appropriate responses to these issues. 3. For more information, see the website of the Bali Process.
beneficiary of international protection BG лице, на което е предоставена международна закрила CS osoba požívající mezinárodní ochrany DE Person, der internationaler Schutz zuerkannt wurde EL δικαιούχος διεθνούς προστασίας Source(s) F Broader term(s) ET rahvusvahelise kaitse saaja international protection FI kansainvälistä suojelua saava Narrower term(s) HU nemzetközi védelemben részesülő személy IT beneficiario di protezione internazionale LT tarptautinės apsaugos gavėjas (EU acquis); prieglobstį gavęs asmuo LV starptautiskās aizsardzības saņēmējs MT Benefiċjarju(-a) ta’ protezzjoni internazzjonali D E ES beneficiario de protección internacional HR osoba s odobrenom međunarodnom zaštitom C A person who has been granted refugee status or subsidiary protection status. EN beneficiary of international protection GA tairbhí den chosaint idirnáisiúnta B Definition(s) Art. 2(b) of Directive 2011/95/EU (Recast Qualification Directive) FR bénéficiaire d’une protection internationale A G H beneficiary of subsidiary protection Convention refugee I Related term(s) J applicant for international protection person eligible for subsidiary protection K EMN Asylum and Migration Classification L 4.1 International protection Euro Voc Classification M 1011 European Union law| 2811 migration NL persoon die internationale bescherming geniet; begunstigde van internationale bescherming (BE) N PL beneficjent ochrony międzynarodowej O PT beneficiário de protecção internacional RO beneficiar de protecție internațională P SK osoba s postavením medzinárodnej ochrany (EU acquis); osoba s udelenou medzinárodnou ochranou Q SL upravičenec do mednarodne zaščite R SV person som beviljats internationellt skydd NO mottaker av internasjonal beskyttelse (asyl) (b); mottakar av internasjonalt vern (asyl) (n) S KA საერთაშორისო დაცვის მიმღები პირი T UK бенефіціар міжнародного захисту HY միջազգային պաշտպանության իրավունք ստացած անձ U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 73
beneficiary of subsidiary protection BG бенефициер на субсидиарна закрила CS osoba požívající doplňkové ochrany DE Person, der subsidiärer Schutz zuerkannt wurde EL δικαιούχος επικουρικής προστασιας (EL); δικαιούχος συμπληρωματικής προστασίας (CY) EN beneficiary of subsidiary protection ES Beneficiario de protección subsidiaria ET täiendava kaitse saaja FI toissijaista suojelua saava henkilö FR bénéficiaire de la protection subsidiaire GA tairbhí cosanta coimhdí HR osoba s odobrenom supsidijarnom zaštitom HU oltalmazott IT Beneficiario di protezione sussidiaria LT papildomos apsaugos gavėjas LV alternatīvās aizsardzības saņēmējs MT Benefiċjarju(-a) ta’ protezzjoni sussidjarja NL persoon die subsidiaire bescherming geniet; begunstigde van subsidiaire bescherming (BE) PL beneficjent ochrony uzupelniającej PT beneficiário de proteção subsidiária RO beneficiar al statutului conferit prin protecție subsidiară SK osoba s poskytnutou doplnkovou ochranou SL upravičenec do subsidiarne zaščite SV alternativt skyddsbehövande NO mottaker av beskyttelse på alternativt grunnlag (b); mottakar av vern på alternativt grunnlag (n) KA დამატებითი დაცვის მიმღები პირი UK бенефіціар додаткового захисту HY 74 օժանդակ պաշտպանության իրավունք ստացած անձ EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Definition(s) A person who has been granted subsidiary protection status. Source(s) Derived by EMN from the definition of ‘beneficiary of international protection’ in Art. 2(b) of Directive 2011/95/ EU (Recast Qualification Directive) Broader term(s) beneficiary of international protection Related term(s) Convention refugee person eligible for subsidiary protection EMN Asylum and Migration Classification 4.1.2 Subsidiary protection Euro Voc Classification 2811 migration
A B benefit of the doubt BG ползване от наличието на съмнение CS v pochybnostech ve prospěch DE im Zweifel für den Antragsteller / im Zweifelsfall zugunsten des Antragstellers / in dubio pro reo EL το ευεργέτημα της αμφιβολίας EN benefit of the doubt ES beneficio de la duda ET kahtluse korral taotleja kasuks FI benefit of the doubt -periaate FR bénéfice du doute GA sochar an amhrais HR blagodat sumnje HU kétség esetén a kérelmező javára IT Beneficio del dubbio LT abejonės aiškinamos prieglobsčio prašytojo naudai LV šaubu tulkošana par labu personai MT Benefiċċju tad-dubbju NL voordeel van de twijfel PL wątpliwości przemawiają na korzyść wnioskodawcy PT benefício da dúvida RO beneficiul dubiului SK v pochybnostiach v prospech SL v dvomu v korist SV tvivelsmålets fördel NO tvilens fordel KA ეჭვის განმცხადებლის სასარგებლოდ გადაწყვეტა UK перевага сумніву HY բարենպաստ կարծիք կամ դատողություն, որն ընդունվել է` չնայած անորոշությանը C D Definition(s) E In the context of international protection, principle that it is the duty of the applicant for international protection to substantiate the application and that aspects of the applicant›s statements that are not supported by documents or other evidence do not need to be confirmed if the conditions set out in Art. 4(5) of Directive 2011/95/EU (Recast Qualification Directive) are met. F G H Source(s) Derived by EMN from Art. 4 (5) of Directive 2011/95/EU (Recast Qualification Directive) and EASO: Practical guide: evidence assessment, 2015 Broader term(s) credibility assessment I J K EMN Asylum and Migration Classification L 4.1 International protection Euro Voc Classification M 1216 criminal law| 1231 international law| 2811 migration N Note(s) 1. Art. 4(5) of the Recast Qualification Directive allows the case officer to make a clear decision on whether to accept an asserted material fact as credible even though there may be no other evidence to support the fact if the following conditions are met: (a) the applicant has made a genuine effort to substantiate their application; (b) all relevant elements at the applicant’s disposal have been submitted, and a satisfactory explanation has been given regarding any lack of other relevant elements; (c) the applicant’s statements are found to be coherent and plausible and do not run counter to available specific and general information relevant to the applicant’s case; (d) the applicant has applied for international protection at the earliest possible time, unless the applicant can demonstrate good reasons for not having done so; and (e) the general credibility of the applicant has been established. The five criteria of Art. 4(5) of the Recast Qualification Directive are cumulative. 2. The principle of giving applicants the benefit of the doubt in credibility assessments is essential due to the potential grave risks to an applicant’s life and/or integrity if international protection is unjustly denied in such cases. This need and its relevance have been acknowledged by the European Court of Human Rights (ECtHR), emphasizing the frequent necessity of granting applicants the benefit of the doubt in evaluating the credibility of their statements. 3. For more information see: EASO: Practical guide evidence assessment, 2015 and UNHCR: Beyond proof: credibility assessment in EU asylum systems, 2013 and UNCHR: Handbook on Procedures and Criteria for Determining Refugee Status under the 1951 Convention and the 1967 Protocol relating to the Status of Refugees, 2019. O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 75
best interests of the child (BIC) BG Най-добрият интерес на детето CS nejlepší zájmy dítěte Definition(s) ES Interés superior del menor A threefold concept which includes a substantive right, a fundamental and interpretative legal principle and a rule of procedure that is aimed at ensuring the full and effective enjoyment of all the rights recognised in the United Nations Convention on the Rights of the Child (UNCRC) and of which the primary consideration is to ensure the holistic development of the child. ET lapse parimad huvid Source(s) DE Wohl des Kindes / Kindeswohl EL υπέρτερο συμφέρον του παιδιού (BIC) (EL); βέλτιστο συμφέρον του παιδιού (BIC) (CY) EN best interests of the child (BIC) IT superiore interesse del minore Derived by EMN from Art. 3(1) of the United Nations Convention of the Rights of the Child and UN General Comment No 14 on the right of the child to have their best interests taken as a primary consideration, 2013 and UNHCR: Guidelines on Determining the best interest of the child, 2008 LT geriausi vaiko interesai Synonym(s) FI lapsen etu FR intérêt supérieur de l’enfant GA Leas an linbh HR najbolji interes djeteta HU a gyermek mindenek felett álló érdeke LV bērna (labākās) intereses MT L-aħjar interessi tat-tifel / tat-tifla NL het belang van het kind (NL); het hoger belang van het kind (BE) best interest of the child BIC principle of the best interest(s) of the child Broader term(s) PL najlepszy interes dziecka child PT superior interesse da criança Narrower term(s) RO interesul superior al copilului SK najlepší záujem dieťaťa SL največja korist otroka SV barnets bästa NO grunnlagsdokument KA ბავშვის საუკეთესო ინტერესები (BIC) UK найкращі інтереси дитини (НІД) HY 76 երեխայի լավագույն շահեր EMN ASYLUM AND MIGRATION GLOSSARY 10.0 child’s best interests assessment (BIA) child’s best interests determination (BID) Related term(s) United Nations Convention on the Rights of the Child (UNCRC) EMN Asylum and Migration Classification 7.2 Minors and unaccompanied minors Euro Voc Classification 2811 migration
A B C D Note(s) E 1. The principle of the best interests of the child is one of the four overarching guiding principles on children’s rights (right to non-discrimination, best interests, the right to life, survival and development, and the right to participation or right to express views and have them taken into account). It is anchored in Art. 3(1) of the Convention on the Rights of the Child and in Art. 24(2) of the Charter of Fundamental Rights of the European Union. Both instruments give children the right to have their best interests taken into account as a primary consideration in all actions or decisions that concern or affect children. In addition, Art. 24(3) of the Charter further addresses the need to take into account the child’s right to maintain a relationship with both parents. This has also been underlined in the case law of the Court of Justice of the European Union (CJEU), e.g. in the Case C-230/21. 2. The holistic development of the child refers to the well-being of a child in a broad sense which includes their basic material, physical, educational and emotional needs as well as needs for affection and safety. 3. The principle applies to all children without discrimination, to children not only as individuals, but also in general or as a group. 4. The child’s best interests assessment (BIA) is an ongoing procedure undertaken in each individual case which evaluates and balances all elements necessary to make a decision in a specific situation for a specific child or group of children to ensure that such procedure gives a primary consideration to the best interests jof the child (BIC). For further information see, EASO: Practical Guide on Family Tracing, 2016, p. 52-53. UNHCR: Safe and Sound, 2014. 5. The child’s best interests determination (BID) describes a formal process with strict procedural safeguards and documentation requirements designed to determine the child›s best interests for particularly important decisions affecting the child and which should facilitate adequate child participation without discrimination and involve decision-makers with relevant areas of expertise, and balance all relevant factors in order to assess the best option. For further information see UNHCR: Guidelines on Determining the best interest of the child, 2008. 6. In the national context, the term is often used in the singular form. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 77
biometric data BG биометрични данни CS biometrické údaje Definition(s) ES datos biométricos Personal data resulting from specific technical processing relating to the physical, physiological or behavioural characteristics of a natural person, which allow or confirm the unique identification of that natural person, such as facial images or dactyloscopic data. ET biomeetrilised andmed Source(s) DE biometrische Daten EL βιομετρικά δεδομένα EN biometric data FI biometriset tiedot FR données biométriques GA sonraí bithmhéadracha HR biometrijski podaci HU biometrikus adat IT dati biometrici LT biometriniai duomenys LV biometriskie dati MT Data / Dejta bijometrika NL biometrische gegevens PL dane biometryczne PT dados biométricos RO date biometrice SK biometrický údaj SL biometrični podatki SV biometriska data NO biometriske data KA ბიომეტრიული მონაცემები UK біометричні дані HY 78 կենսաչափական տվյալներ EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Art. 4 (14) of Regulation (EU) 2016/679 (General Data Protection Regulation) and Art. 3 (13) of Directive (EU) 2016/680 (Data Protection Directive) Synonym(s) biometrics EMN Asylum and Migration Classification 6.3.2. Establishment of identity of applicants for international protection (incl. examination of documents, language analysis, age assessment) Euro Voc Classification 2811 migration
A B Black Sea Synergy BG Черноморско сътрудничество CS Černomořská synergie DE Schwarzmeersynergie EL Συνέργεια του Ευξείνου Πόντου EN Black Sea Synergy ES Sinergia del mar Negro ET Musta mere sünergia (koostöö) FI Mustanmeren synergia FR Synergie de la mer Noire GA Sineirge na Mara Duibhe HR Crnomorska sinergija C D Definition(s) E An institutionalised forum for EU cooperation encouraging cooperation between the EU and the countries surrounding the Black Sea and for tackling common problems while encouraging political and economic reform. F G Source(s) Website of the Black Sea Synergy H Broader term(s) European Neighbourhood Policy (ENP) I Related term(s) HU Fekete-tengeri szinergia Eastern Partnership (EAP) Euro-Mediterranean Partnership (EUROMED) J IT Sinergia del Mar Nero EMN Asylum and Migration Classification LT Juodosios jūros sinergija 15.1 EU External dimension of migration and mobility K LV Melnās jūras reģiona sinerģija Euro Voc Classification L MT Sinerġija tal-Baħar l-Iswed NL Black Sea Synergy (no usual translation) PL Synergia Czarnomorska PT Sinergia do Mar Negro RO Sinergia Marii Negre SK Čiernomorská synergia SL Sinergija Črnega morja SV Svartahavssynergin NO Svartehavssynergien KA შავი ზღვის სინერგია UK Чорноморська синергія HY 2811 migration| 7616 extra-European Organisations M Note(s) 1. The Black Sea Synergy is part of the European Neighbourhood Policy (ENP) of the EU and is intended as a flexible framework complementing existing EU policy, seeking to tackle the significant opportunities and challenges in the Black Sea area that require coordinated action at the regional level in the sectors such as energy, transport, environment, migration and security. In the field of migration and security enhanced cooperation at border security increases the security at regional level and helps to fight organised cross-border crime such as trafficking in human beings, and to prevent irregular migration. 2. A conference between EU and Black Sea Foreign Affairs Ministers in Kiev (Ukraine) in 2008 initiated the synergy. 3. For more information, see: Black Sea Synergy -A new regional cooperation initiative, COM(2007) 160 final, 11 April 2007. N O P Q R Սևծովյան համագործակցություն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 79
border area BG гранична зона CS pohraniční oblast Definition(s) DE Grenzgebiet / Grenzregion An area that extends no more than 30 kilometres from the border. EL παραμεθόρια περιοχή / συνοριακή περιοχή Source(s) EN border area ES zona fronteriza ET piiriala FI raja-alue FR zone frontalière GA limistéar teorann HR pogranično područje HU határmenti terület IT zona di frontiera LT pasienio teritorija LV pierobeža MT Żona ta’ mal-konfini NL grensgebied PL strefa przygraniczna PT zona fronteiriça RO zonă de frontieră SK pohraničná oblasť (EU acquis); prihraničné územie SL obmejno območje SV gränsområde NO grenseområde KA სასაზღვრო ზონა UK прикордонна територія HY 80 սահմանամերձ շրջան EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Art. 3(2) of Regulation (EC) No 1931/2006 (Local Border Traffic Regulation) Related term(s) border resident local border traffic EMN Asylum and Migration Classification 6.1.1 Border control Euro Voc Classification 2811 migration Note(s) Subsequent to Art. 3(2) of Regulation (EC) No 1931/2006 (Local Border Traffic Regulation) , an EU Member State may specify the local administrative districts that are to be considered part of ‹the border area› in a bilateral agreements with its neighbouring third country(s). If part of any such district lies between 30 and 50 kilometres from the border line, it shall nevertheless be considered as part of the border area.
A B border control BG граничен контрол CS pohraniční kontrola C ES control fronterizo The activity carried out at a border, in accordance with and for the purposes of Regulation (EU) 2016/399 (Schengen Borders Code) , in response exclusively to an intention to cross or the act of crossing that border, regardless of any other consideration, consisting of border checks and border surveillance. ET piirikontroll Source(s) DE Grenzkontrolle EL συνοριακός έλεγχος / έλεγχος των συνόρων EN border control FI rajavalvonta FR contrôle aux frontières GA rialú teorann D Definition(s) E F G H Art. 2(9) of Regulation (EU) 2016/399 (Schengen Borders Code) I Related term(s) MT Kontroll mal-konfini / mal-fruntiera European Border Surveillance System (EUROSUR) external EU border internal EU border irregular entry legal entry refusal of entry Schengen Borders Code NL grenstoezicht / grensbewaking / grenscontrole EMN Asylum and Migration Classification M Euro Voc Classification N HR nadzor državne granice HU határellenőrzés IT controllo di frontiera LT sienų kontrolė (EU acquis); pasienio kontrolė LV robežkontrole PL kontrola graniczna PT controlo de fronteira RO control de frontieră J K L 6.1.1 Border control 2811 migration O SK kontrola hraníc SL nadzor meje P SV gränskontroll NO grensekontroll Q KA სასაზღვრო კონტროლი R UK прикордонний контроль HY սահմանային հսկողություն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 81
border crossing BG пресичане на границата CS překročení hranice Definition(s) DE Grenzübertritt The physical act of crossing a border either at a border crossing point or another point along the border. EL διέλευση των συνόρων Source(s) EN border crossing Developed by EMN ES cruce de frontera Narrower term(s) ET piiriületus border crossing point FI rajanylitys Related term(s) FR franchissement de la frontière GA trasnú teorann HR prelazak državne granice HU határátlépés IT attraversamento della frontiera LT sienos kirtimas LV robežšķērsošana MT Qsim tal-konfini / tal-fruntiera (i) NL grensoverschrijding PL przekraczanie granicy PT passagem de fronteira RO trecerea frontierei SK prekročenie hranice / prekročenie štátnej hranice SL prečkanje meje / prehajanje meje / prestopanje meje SV gränspassage NO grensepassering KA საზღვრის კვეთა UK перетин кордону HY 82 սահմանի անցում EMN ASYLUM AND MIGRATION GLOSSARY 10.0 legal entry irregular entry EMN Asylum and Migration Classification 6.1.1 Border control Euro Voc Classification 2811 migration Note(s) The definition covers both legal and irregular border crossings.
A B border crossing point BG гранично-пропускателен пункт CS hraniční přechod C D Definition(s) DE Grenzübergang / Grenzübergangsstelle Any crossing point authorised by the competent authorities for the crossing of external EU borders. E EL σημείο συνοριακής διέλευσης Source(s) F EN border crossing point ES paso fronterizo ET piiriületuspunkt FI rajanylityspaikka FR point de passage frontalier GA pointe trasnaithe teorann HR granični prijelaz HU határátkelőhely Art. 2(8) of Regulation (EU) 2016/399 (Schengen Borders Code) G Broader term(s) H border crossing EMN Asylum and Migration Classification I 6.1.1 Border control Euro Voc Classification J 2811 migration IT valico di frontiera K LT sienos perėjimo punktas L LV robežšķērsošanas vieta MT Punt / Post ta’ qsim il-fruntiera / il-konfini M NL grensovergang / grensdoorlaatpost / grenspost PL przejście graniczne N PT ponto de passagem fronteiriço RO punct de trecere a frontierei O SK hraničný priechod SL mejni prehod P SV gränsövergångsställe NO grensepasseringssted (b); grensepasseringsstad (n) Q KA სასაზღვრო გამტარი პუნქტი R UK пункт перетину кордону HY S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 83
border resident BG граничен жител CS obyvatel pohraniční oblasti Definition(s) ES residente fronterizo In the EU migration context, a third–country national who has been lawfully resident in the border area of a country neighbouring an EU Member State for a period specified in a bilateral agreement between an EU Member State(s) and neighbouring third country, which shall be at least one year. ET piiriala elanik Source(s) DE Grenzbewohner EL κάτοικος της μεθορίου περιοχής EN border resident FI raja-alueen asukas FR frontalier (EU acquis); résident frontalier GA cónaitheoir teorann HR stanovnik pograničnog područja HU határmenti lakos IT residente frontaliero LT pasienio gyventojas LV pierobežas iedzīvotājs MT Resident(a) ta’ mal-konfini / mal-fruntiera NL grensbewoner PL mieszkaniec strefy przygranicznej PT residente fronteiriço RO locuitor din zona de frontieră SK obyvateľ pohraničnej oblasti SL obmejni prebivalec SV gränsboende NO grenseboer (b); grensebuar (n) KA სასაზღვრო ზონაში მცხოვრები პირი UK житель прикордонного району HY 84 սահմանամերձ շրջանի բնակիչ EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Art. 3(6) of Council Regulation (EC) No 1931/2006 (Local Border Traffic Regulation) Related term(s) border area frontier worker local border traffic EMN Asylum and Migration Classification 3. Legal Migration Euro Voc Classification 2811 migration
A B brain circulation BG движение на мозъци CS cirkulace mozků DE Brain Circulation EL κυκλοφορία εγκεφάλων (EL); brain circulation (CY) EN brain circulation ES circulación de cerebros ET oskustööjõu ringlus C D Definition(s) E The possibility for developing countries to draw on the skills, know-how and other forms of experience gained by their migrants - whether they have returned to their country of origin or not - and members of their diaspora. F G Source(s) FI aivokierto Annex 5 of the European Commission Communication on Migration and Development, COM(2005) 390 final FR circulation des cerveaux Related term(s) HU there is no widely accepted term: „agykörforgás” is used in some documents brain drain brain gain brain waste circular migration IT circolazione di cervelli EMN Asylum and Migration Classification GA cúrsaíocht daoine oilte HR cirkulacija mozgova LT protų apykaita LV kvalificēta darbaspēka aprite MT Ċirkolazzjoni ta’ mħuħ / ta’ nies bi kwalifiki għoljin NL mobiliteit van hoogopgeleide personen / brain circulation I J K 14.2 Economic factors and impacts (such as brain drain/ gain, employment/ unemployment, labour market, economic growth, dumping) Euro Voc Classification 2811 migration| 44 Employment and Working Conditions PL przepływ mózgów/potencjału L M N O PT circulação de cérebros RO circulaţia creierelor P SK cirkulácia mozgov SL kroženje možganov Q SV kunskapsspridning NO kunnskapsmobilitet / kunnskapssirkulasjon R KA ინტელექტის ცირკულაცია UK циркуляція мізків HY H S ուղեղների շրջանառություն T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 85
brain drain BG изтичане на мозъци CS odliv mozků Definition(s) DE Brain Drain The loss suffered by a country as a result of the emigration of a (highly) qualified person. EL διαρροή εγκεφάλων (EL); brain drain (CY) Source(s) EN brain drain Derived by EMN from ILO Thesaurus ES fuga de cerebros Related term(s) ET oskustööjõu äravool FI aivovienti FR fuite des cerveaux GA imirce daoine oilte brain gain brain waste brain circulation EMN Asylum and Migration Classification HU agyelszívás / a képzett munkaerő elvándorlása 14.2 Economic factors and impacts (such as brain drain/ gain, employment/ unemployment, labour market, economic growth, dumping) IT fuga di cervelli Euro Voc Classification HR odlijev mozgova LT protų nutekėjimas LV kvalificēta darbaspēka aizplūšana MT Telf/Tnixxija ta’ mħuħ / ta’ nies bi kwalifiki għoljin NL brain drain PL drenaż mózgów PT fuga de cérebros RO exodul creierelor / brain drain SK únik mozgov (EU acquis); odliv mozgov SL beg možganov SV kompetensflykt NO kunnskapsflukt / ekspertflukt KA ინტელექტის გადინება UK відтік мізків HY 86 ուղեղների արտահոսք EMN ASYLUM AND MIGRATION GLOSSARY 10.0 2811 migration| 44 Employment and Working Conditions
A B brain gain BG привличане на мозъци CS příliv mozků C D Definition(s) DE Brain Gain The benefit to a country as a result of the immigration of a highly qualified person. E EL κέρδος εγκεφάλων (EL); brain gain (CY) Source(s) F EN brain gain ES captación de cerebros ET oskustööjõu sissevool FI aivotuonti FR afflux de cerveaux GA inimirce daoine oilte HR priljev mozgova HU agynyerés / a képzett munkaerő bevándorlása IT acquisizione di cervelli LT protų pritraukimas LV kvalificēta darbaspēka pieplūdums MT Akkwist/Ksib ta’ mħuħ / ta’ nies bi kwalifiki għoljin NL brain gain PL brain gain (pozyskiwanie mózgów/potencjału) PT captação de cérebros RO atragerea creierelor / brain gain SK získavanie mozgov SL pridobivanje možganov / priliv možganov Derived by EMN from the definition of ‘brain drain’ in the EMN Glossary Synonym(s) H reverse brain drain Related term(s) brain drain brain waste brain circulation circular migration I EMN Asylum and Migration Classification K J 14.2 Economic factors and impacts (such as brain drain/ gain, employment/ unemployment, labour market, economic growth, dumping) L Euro Voc Classification M 2811 migration| 44 Employment and Working Conditions N Note(s) This can apply to, for example, an EU Member State receiving a highly qualified migrant, as well as a third-country national returning to their country of origin. O P SV kompetensinflöde NO kunnskapsgevinst Q KA ინტელექტის შემოდინება R UK притік мізків HY G ուղեղների ներհոսք S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 87
brain waste BG разхищение на мозъци CS plýtvání mozky DE Brain Waste EL κατασπατάληση εγκεφάλων (EL); brain waste (CY) EN brain waste ES subempleo ET oskustööjõu alarakendatus FI aivotuhlaus FR gaspillage des cerveaux Definition(s) The non-recognition of the skills (and qualifications) acquired by a migrant outside of the EU, which prevents them from fully using their potential. Source(s) Derived by EMN from Footnote 28 of the European Commission Communication on Migration and Development, COM(2005) 390 final Related term(s) HR rasipanje mozgova brain drain brain gain brain circulation HU képességek elpazarlása EMN Asylum and Migration Classification GA cur amú éirime IT spreco di cervelli LT protų švaistymas LV intelektuālā potenciāla izšķērdēšana MT Ħela ta’ mħuħ / ta’ nies bi kwalifiki għoljin NL brain waste PL marnotrastwo mózgów/potencjału PT desperdício de competências RO irosire a inteligenței SK plytvanie mozgami (EU acquis); mrhanie mozgami SL tratenje možganov SV kompetensslöseri NO kunnskapssløsing KA ინტელექტის გაფლანგვა UK втрата мізків HY 88 ուղեղների վատնում EMN ASYLUM AND MIGRATION GLOSSARY 10.0 14.2 Economic factors and impacts (such as brain drain/ gain, employment/ unemployment, labour market, economic growth, dumping) Euro Voc Classification 2811 migration| 44 Employment and Working Conditions
A B breeder documents BG Документи за легитимация CS matriční doklady Documents used to support applications for identity, residence and travel documents, such as birth, marriage and death certificates. EL έγγραφα βάσης Source(s) ES Documentos primarios (documento de filiación) ET alusdokumendid FI lähdeasiakirjat D Definition(s) DE Ausgangsdokumente (EU-acquis); no usual translation in DE EN breeder dcouments C E F Footnote 7 of European Commission: Communication ‘Action plan to strengthen the European response to travel document fraud’, COM (2016) 790 final G H EMN Asylum and Migration Classification GA Doiciméid phórúcháin 6.3.2. Establishment of identity of applicants for international protection (incl. examination of documents, language analysis, age assessment) HR izvodi iz matičnih knjiga / no usual translation Euro Voc Classification FR documents sources HU anyakönyvi dokumentumok IT documenti originatori LT pirminiai dokumentai LV izcelsmes dokumenti MT Dokumenti primarji / mis-sors 2811 migration I J K Note(s) L The term can be used in different contexts, most commonly it is used in the context of fraud, such as in the Communication of the Commission, COM(2016) 790 final which presents an action plan to tackle the phenomenon of travel document fraud. M NL onderliggende documenten N PL dokumenty źródłowe PT documentos a montante O RO documente primare SK východiskové doklady (EU acquis); zdrojové doklady SL dokumenti o izvoru P SV stödjande ID-dokumentation / bakomliggande dokument Q NO Transportørs ansvar R KA პირველადი (ძირი) დოკუმენტები UK документи, що посвідчують особу HY S հիմնական փաստաթուղթեր T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 89
Budapest Process BG Будапещенски процес CS Budapešťský proces Definition(s) FR Processus de Budapest A consultative forum of more than 50 governments from the wider European region and ten international organisations, which aims to promote good governance in the field of migration, to develop comprehensive and sustainable systems for orderly migration and to exchange information and best practices on a wide range of migration issues (legal migration, irregular migration, asylum, visa, border management, trafficking in human beings and smuggling of migrants, readmission and return). GA Próiseas Bhúdaipeist Source(s) DE Budapest-Prozess EL Διαδικασία της Βουδαπέστης EN Budapest Process ES Proceso de Budapest ET Budapesti protsess FI Budapestin prosessi HR Budimpeštanski proces HU Budapest Folyamat IT Processo di Budapest LT Budapešto procesas LV Budapeštas process MT Proċess (Il-) ta’ Budapest NL Boedapest proces PL Proces Budapeszteński PT Processo de Budapeste RO Procesul Budapesta SK Budapeštiansky proces SL Budimpeštanski proces SV Budapestprocessen NO Budapest-prosessen KA ბუდაპეშტის პროცესი UK Будапештський процес HY 90 Բուդապեշտի գործընթաց EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Derived by EMN from the Website of ICMPD describing Budapest Process and the Website of the Budapest Process Related term(s) Global Approach to Migration and Mobility (GAMM) EMN Asylum and Migration Classification 15.1 EU External dimension of migration and mobility Euro Voc Classification 2811 migration| 76 International Organisations Note(s) 1. The Budapest Process was initiated by DE in 1991. 2. Through this dialogue, the Process promotes a harmonised approach in dealing with irregular migration challenges and support for the transfer and common understanding of migration concepts and policies. 3. For more information see the website of the Budapest Process.
A B burden of proof BG тежест на доказване CS důkazní břemeno DE Beweislast EL βάρος της αποδείξεως EN burden of proof ES carga de la prueba ET tõendamiskohustus FI todistustaakka FR charge de la preuve GA dualgas cruthúnais HR teret dokaza C D Definition(s) In the global context, a party’s duty to prove a disputed assertion or charge. In themigration context, the duty of a non-national seeking entry into a foreign State to prove that they are entitled to enter and not inadmissible under the laws of that State. In the context of refugee status determination procedures, the duty of the applicant to establish their case, to produce evidence that they have a wellfounded fear of persecution. Source(s) E F G H I HU bizonyítási teher Derived by EMN from the IOM Glossary on Migration, 2019. J IT onere della prova EMN Asylum and Migration Classification K LT įrodinėjimo pareiga LV pierādīšanas pienākums MT Piż (Il-) tal-prova / Obbligu (L-) li jinġiebu l-provi NL bewijslast PL ciężar dowodu PT ónus da prova RO sarcina probei SK dôkazné bremeno SL dokazno breme SV bevisbörda NO bevisbyrde 6.2 Procedure for international protection/Refugee status determination| 6.3 Specific aspects of migration procedures Euro Voc Classification M 12 Law| 2811 migration N Note(s) 1. In refugee status determination procedures, it is the applicant who has the burden of establishing the veracity of their allegations and the accuracy of the facts on which the refugee claim is based. The burden of proof is discharged by the applicant rendering a truthful account of facts relevant to the claim so that, based on the facts, a proper decision may be reached. 2. For further information see UNHCR: Note on Burden and Standard of Proof in Refugee Claims, 16 December 1998. KA მტკიცების ტვირთი O P Q R UK тягар доведення HY L ապացուցման պարտականություն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 91
carrier BG превозвач CS dopravce Definition(s) DE Transportunternehmen / Beförderungsunternehmen In relation to conveyance (or transport), the owner or charterer of the conveyance. EL μεταφορέας Source(s) EN carrier Developed by EMN ES operador de transporte EMN Asylum and Migration Classification ET vedaja 6.3 Specific aspects of migration procedures FI liikenteenharjoittaja Euro Voc Classification FR transporteur GA iompróir HR prijevoznik HU fuvarozó IT vettore LT vežėjas LV pārvadātājs MT Operatur tat-trasport NL vervoerder PL przewoźnik PT transportador RO transportator SK dopravca SL prevoznik SV transportör NO transportør KA გადამყვანი კომპანია UK перевізник HY 92 փոխադրող EMN ASYLUM AND MIGRATION GLOSSARY 10.0 2811 migration Note(s) 1. A carrier usually refers to an airline, bus or rail company, or cruise line. Under the laws of some States, the term includes any owner of a means of conveyance, which carries a person onto its territory. 2. The definition given in Art. 2(a) of Council Directive 2004/82/EC (API Directive) is more restrictive in that it refers explicitly to passenger transport by air and there is uncertainty as to what ‹any natural or legal person› actually refers to, e.g. if this is the owner of the company only.
A B carriers’ liability BG отговорност на превозвачите CS odpovědnost dopravce DE Haftung von Transportunternehmen / Haftung von Beförderungsunternehmen EL ευθύνης του µεταφορέα EN carriers’ liability ES responsabilidad de los transportistas ET veoettevõtjate vastutus FI liikenteenharjoittajien velvollisuudet FR responsabilité des transporteurs GA Dliteanas iompróirí HR odgovornost prijevoznika HU fuvarozók felelőssége IT obbligo del vettore LT vežėjo atsakomybė C D Definition(s) In the migration context, obligation of carriers to return third-country nationals who are not in possession of the necessary travel documents to enter the EU Member State/Schengen state of arrival. E Source(s) G Art.26 (1a) of the Schengen Convention and Directive 2001/51/EC (Carriers Liability Directive) and Art. 2 of Council Directive 2004/82/EC (Directive on the obligation of carriers to communicate passenger data) H I Related term(s) carriers’ sanction J EMN Asylum and Migration Classification 6.3 Specific aspects of migration procedures K Euro Voc Classification 2811 migration L Note(s) M LV pārvadātāja pienākums MT Obbligu(-i) tal-operaturi tat-trasport NL vervoerdersaansprakelijkheid PL odpowiedzialność przewoźnika PT responsabilidade dos transportadores RO răspunderea transportatorilor SK zodpovednosť dopravcov a prepravcov SL odgovornost prevoznikov 1. Carriers which are unable to effect the return of a third-country national whose entry is refused are liable to find means of onward transportation immediately and to bear the cost thereof, or, if immediate onward transportation is not possible, they are liable for the costs of the stay and return of the third-country nationals towards a non-Schengen state. 2. IE, although not part of the Schengen area, has expressed its wish to participate in certain aspects of the Schengen acquis, through Council Decision 2002/192/EC to participate in certain aspects of the Schengen acquis, including Art. 26 of the Schengen Convention. SV transportörsansvar N O P Q NO transportørs ansvar KA გადამყვანის პასუხისმგებლობა R UK відповідальність перевізників HY F S փոխադրողի պատասխանատվություն T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 93
case worker in procedures for international protection BG интервюист CS rozhodčí v řízení o udělení mezinárodní ochrany DE Sachbearbeiter in Verfahren für internationalen Schutz; Referent in Verfahren für internationalen Schutz (AT) EL χειριστής υποθέσεων διεθνούς προστασίας EN case worker in procedures for international protection ES trabajador social en procedimientos de protección internacional ET Rahvusvahelise kaitse taotluse menetleja FI päätöksen tekijä / hakemuksen käsittelijä kansainvälisen suojelun menettelyssä FR agent responsable du traitement des demandes de protection internationale MT Operatur(-triċi) soċjali fi proċeduri għall-protezzjoni internazzjonali NL hoor- en beslisambtenaar in asielzaken (NL); protection officer (BE) PL pracownik / urzędnik prowadzący postępowanie w sprawach z zakresu ochrony międzynardowej PT instrutor do procedimento de proteção internacional RO ofițer de decizie în procedurile de examinare a cererii de azil SK rozhodovač v konaniach o udelenie medzinárodnej ochrany / rozhodovač v konaniach o udelenie azylu SL pristojna uradna oseba v postopku mednarodne zaščite SV handläggare av ansökningar om internationellt skydd HR voditelj postupka međunarodne zaštite NO saksbehandler for søknad om internasjonal beskyttelse (asyl) (b); sakshandsamar for søknad om internasjonalt vern (asyl) (n) HU menekültügyi eljárás során eljáró ügyintézők KA საერთაშორისო დაცვის მოთხოვნის შესახებ GA cásoibrí nósanna imeachta um chosaint idirnáisiúnta IT operatore impegnato nella procedura di protezione internazionale LT prašymą nagrinėti ir sprendimą dėl prieglobsčio suteikimo priimti įgaliotas valstybės tarnautojas LV ierēdnis, kurš izskata starptautiskās aizsardzības pieteikumus 94 EMN ASYLUM AND MIGRATION GLOSSARY 10.0 განცხადების განმხილველი პირი UK уповноважена посадова особа у процедурах міжнародного захисту HY միջազգային պաշտպանության հարցերի գործ վարող
A B C D Definition(s) Personnel of the determining authority responsible for examining and assessing an application for international protection and competent to take a decision at first instance in such a case. E Source(s) G F Derived by EMN from the definition of ‘decision maker’ in UNHCR: Beyond Proof -Credibility Assessment in EU Asylum Systems, 2013 H Synonym(s) I asylum case worker asylum determination officer case officer case worker decision-maker J K Related term(s) L EMN Asylum and Migration Classification M determining authority 6.2 Procedure for international protection/Refugee status determination N Euro Voc Classification 12 Law| 2811 migration O Note(s) P This term specifically refers to persons examining and assessing applications for international protection. There are other types of case workers i.e. for processing visa applications, which are not explicitely mentioned in the glossary with an extra term. Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 95
Centre for Information, Discussion and Exchange on the Crossing of Frontiers and Immigration (CIREFI) BG Център за информация, дискусии и обмен оносно преминаването на границите и имиграцията LT Informacijos, diskusijų ir keitimosi duomenimis sienų kirtimo ir imigracijos klausimais centras CS Centrum pro informace, diskusi a výměnu názorů k překračování hranic a imigraci LV Robežšķērsošanas un imigrācijas jautājumu informācijas, apspriežu un informācijas apmaiņas centrs DE Informations-, Reflexions- und Austauschzentrum für Fragen im Zusammenhang mit dem Überschreiten der Außengrenzen und der Einwanderung MT Ċentru (Iċ-) ta’ Informazzjoni, Diskussjoni u Skambji dwar il-Qsim ta’ Fruntieri u l-Immigrazzjoni EL Κέντρο Πληροφόρησης, Μελετών και Ανταλλαγών στον τομέα της διέλευσης των συνόρων και της μετανάστευσης NL Centrum voor informatie, beraad en gegevensuitwisseling inzake grensoverschrijding en immigratie EN Centre for Information, Discussion and Exchange on the Crossing of Frontiers and Immigration (CIREFI) PL Centrum Wymiany Informacji nt. Przekraczania Granic i Imigracji ES Centro de información, reflexión e intercambio en materia de cruce de fronteras e inmigración PT Centro de Informação, Reflexão e Intercâmbio em matéria de Passagem das Fronteiras e Imigração ET piiriületuse- ja sisserändealase teabe, analüüsi ja infovahetuse keskus RO Centrul de informare, reflecţie şi schimb de informaţii cu privire la trecerea frontierei şi imigraţie FI Rajanylitys-ja maahanmuuttoasioiden tiedotus-, tarkastelu- ja tietojenvaihtokeskus SK Centrum pre informácie, diskusiu a výmenu v oblasti prekračovania hraníc a prisťahovalectva (CIREFI) FR Centre d’information, de réflexion et d’échanges en matière de franchissement des frontières et d’immigration SL Center za informacije, razprave in izmenjave podatkov o prečkanju meja in priseljevanju GA an Lárionad um Fhaisnéis, Plé agus Malartú i dtaca le Trasnú Imeallchríche agus Inimirce HR Centar za informacije, raspravu i razmjenu podataka o prelasku granica i useljavanju (CIREFI) HU Külső Határok Átlépésével és Bevándorlással foglalkozó Információ-, Vita-, és Véleménycsere Központ IT Centro di Informazione, di Riflessione e di Scambi in materia di Attraversamento delle Frontiere e di Immigrazione 96 EMN ASYLUM AND MIGRATION GLOSSARY 10.0 SV Centrum för information, diskussion och utbyte i frågor som rör passage av gränser och invandring NO Senter for informasjon, diskusjon og utveksling om grensepassering og innvandring KA საზღვრის კვეთისა და იმიგრაციის საკითხებზე ინფორმაციის მიმოცვლისა და ანალიზის ცენტრი (CIREFI) UK Центр інформації, обговорень і обміну даними про перетин кордону та імміграцію (CIREFI) HY Սահմանների հատման և ներգաղթի վերաբերյալ տեղեկատվության, քննարկման և փոխանակման կենտրոն
A B C D E Definition(s) F A body assisting the EU Member States in effectively studying legal migration so as to prevent irregular migration and unlawful residence, in effectively combating immigration crime, in better detecting forged documents and in improving expulsion practice. G H Source(s) Council Conclusions of 30 November 1994 on Cirefi I Synonym(s) J CIREFI Related term(s) K European Border and Coast Guard Agency (Frontex) Euro Voc Classification 2811 migration L Note(s) M 1. CIREFI started its work on 1 January 1995 based on the Council conclusions of 30 November 1994. 2. In December 2009, as a consequence of the entry into force of the Lisbon Treaty, COREPER decided to abolish CIREFI and to transfer its functions to the European Border and Coast Guard Agency (FRONTEX). N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 97
chain migration BG верижна миграция CS řetězová migrace DE Kettenmigration EL μεταναστευτική αλυσίδα EN chain migration ES cadena migratoria Definition(s) The practice where those who have settled on a family reunification basis can themselves sponsor further family members, consistent with European Convention on Human Rights (ECHR) obligations. Source(s) ET ahelränne EMN: Family Reunification of Third-Country Nationals in the EU plus Norway: National Practices, 2016 FI ketjumaahanmuutto Related term(s) FR migration en chaîne IT catena migratoria family formation family migration family reunification right to family life right to family unity LT grandininė migracija EMN Asylum and Migration Classification GA imirce shlabhrúil HR lančane migracije HU lánc-migráció LV ķēdes migrācija MT Katina ta’ migrazzjoni NL kettingmigratie PL migracja łańcuchowa PT migração em cadeia RO migratie in lant SK reťazová migrácia SL verižna migracija SV kedjemigration NO kjedemigrasjon KA ჯაჭვური მიგრაცია UK ланцюгова міграція HY 98 շղթայական միգրացիա EMN ASYLUM AND MIGRATION GLOSSARY 10.0 3.2 Migration for Family Reasons Euro Voc Classification 2806 family| 2811 migration Note(s) 1. Originally chain migration refers to a process in which initial movements of migrants lead to further movements from the same area to the same area. In a chain migration system, individual members of a community migrate and then encourage or assist further movements of migration (see Bundeszentrale für politische Bildung (BpB): Migration, Citizenship, Education Glossary of Terms). 2. Chain migration may also be based on ethnic or family ties with members of the same family migrating at different times, usually with primary wage earners migrating first, followed by secondary or non-wage earners. In countries with more or less liberal regulations on the rights of migrants to family reunification usually in accordance with international conventions, family reunification as an incidence of chain migration explains much of the growth in the total migrant population.
A B change of status BG Промяна на статута CS změna statusu nebo pobytového oprávnění DE Änderung des Rechtsstatus EL αλλαγή καθεστώτος EN change of status ES Cambio de status ET õigusliku staatuse muutmine FI oleskelulupastatuksen muutos FR changement de statut GA athrú stádais HR promjena statusa HU státuszváltozás / státuszváltás IT Cambiamento di status LT statuso keitimas LV statusa maiņa MT Tibdil ta’ status NL wijziging van verblijfsstatus C D Definition(s) E A change in the legal status, due to a change in the purpose of stay, of a third-country national present in EU and/or EFTA Member States, which takes place without requiring the individual to leave the State or return to their country of origin. F G Source(s) Derived by EMN on the basis of the EMN Focussed Study: Changes in immigration status and purpose of stay: an overview of EU Member States’ approaches, 2015. H I Euro Voc Classification 1011 European Union law| 2811 migration J Note(s) K The EMN Focussed Study on ‘Changes in immigration status and purpose of stay’ (2015) considered changes from legal migration status (student, researcher, employee, family member), from asylum seeker status and from national statuses linked to protection (e.g. tolerated stay). It did not consider changes of status resulting from regularisations. PL zmiana statusu pobytowego L M N PT alteração de estatuto RO schimbare de statut O SK zmena statusu SL sprememba statusa P SV statusbyte NO endring av oppholdsgrunnlag (b); endring av opphaldsgrunnlag (n) Q KA სტატუსის შეცვლა R UK зміна статусу HY S կարգավիճակի փոփոխություն T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 99
Charter of Fundamental Rights of the European Union BG Харта на основните права на Европейския съюз CS Listina základních práv Evropské unie Definition(s) EL Χάρτης των Θεμελιωδών Δικαιωμάτων της Ευρωπαϊκής Ένωσης The formal EU document which combines and declares all the values and fundamental rights of individuals (economic and social as well as civil and political) to which EU Member States are obliged. EN Charter of Fundamental Rights of the European Union Source(s) DE Charta der Grundrechte der Europäischen Union ES Carta de los Derechos Fundamentales de la Unión Europea ET Euroopa Liidu põhiõiguste harta Derived by EMN from the Charter of Fundamental Rights of the European Union Synonym(s) FR Charte des droits fondamentaux de l’Union européenne EU Charter of Fundamental Rights EU Fundamental Rights Charter European Union Charter of Fundamental Rights GA Cairt um Chearta Bunúsacha an Aontais Eorpaigh Related term(s) FI Euroopan unionin perusoikeuskirja HR Povelja Europske unije o temeljnim pravima HU Az Európai Unió Alapjogi Chartája IT Carta dei Diritti Fondamentali dell’Unione Europea LT ES pagrindinių teisių chartija LV Eiropas Savienības Pamattiesību harta MT Karta tad-Drittijiet Fundamentali tal-Unjoni Ewropea NL Handvest van de grondrechten van de Europese Unie PL Karta Praw Podstawowych Unii Europejskiej PT Carta Europeia dos Direitos Fundamentais RO Carta Drepturilor Fundamentale a Uniunii Europene SK Charta základných práv Európskej únie SL Listina Evropske unije o temeljnih pravicah SV Europeiska unionens stadga om de grundläggande rättigheterna NO Den europeiske unions pakt om grunnleggende rettigheter (b); pakta til Den europeiske unionen om grunnleggjande rettar (n) European Convention on Human Rights (ECHR) European Union Agency for Fundamental Rights (FRA) human rights EMN Asylum and Migration Classification Euro Voc Classification 1011 European Union law Note(s) 1. The Charter was proclaimed in December 2000 and became binding in December 2009 when the Lisbon Treaty came into force. 2. The Charter does not establish new rights, but assembles existing rights that were previously scattered over a range of international sources and thus makes them more visible. The Charter reaffirms, with due regard for the powers and tasks of the Union and for the principle of subsidiarity, the rights as they result, in particular, from the constitutional traditions and international obligations common to the Member States, the European Convention on Human Rights (ECHR), the Social Charters adopted by the Union and by the Council of Europe and the case-law of the Court of Justice of the European Union and of the European Court of Human Rights (ECtHR). 3. For more information, see the Charter of Fundamental Rights of the European Union. KA ევროკავშირის ძირითად უფლებათა ქარტია UK Хартія основних прав Європейського Союзу HY 100 Եվրոպական Միության Հիմնարար Իրավունքների Խարտիա EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B child BG дете CS dítě DE Kind EL παιδί EN child ES población infantil ET laps FI lapsi FR enfant GA leanbh HR dijete HU gyermek IT bambino - bambina / minore LT vaikas LV bērns MT Tifel (Tifla) / Wild NL kind PL dziecko PT criança RO copil SK dieťa SL otrok SV barn NO barn KA ბავშვი C D Definition(s) Every human being below the age of 18 years, unless under the law applicable to the child, majority is attained earlier or later. Source(s) Art. 1 of UN Convention on the Rights of the Child F G Narrower term(s) H child labour Related term(s) I adult age assessment minor J EMN Asylum and Migration Classification K 7.2 Minors and unaccompanied minors Euro Voc Classification 2806 family L Note(s) M 1. There is still no concrete, consistent definition of ‘child’ under EU law. The Lisbon Treaty introduced an objective for the EU to promote children›s rights. Moreover the Charter of Fundamental Rights of the European Union guarantees the protection of children›s rights by EU institutions, as well as by EU countries when they implement EU law. For further information, see the webpage of DG Justice on the Rights of the Child and Fundamental Rights Agency (FRA): Developing indicators for the protection, respect and promotion of the rights of the child in the European Union, March 2009 2. The term should be used to describe the relationship with other family members. When referring to an individual and in a more legal context, the term minor should be used. N O P Q R UK дитина HY E երեխա S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 101
child labour BG детски труд CS dětská práce DE Kinderarbeit EL παιδική εργασία EN child labour ES trabajo infantil ET lapstööjõu kasutamine FI lapsityö FR travail des enfants GA fostú leanaí HR dječji rad HU gyerekmunka IT lavoro infantile LT vaikų darbas LV bērnu darbs MT Tħaddim ta’ tfal / ta’ minorenni / Sfruttament ta’ xogħol it-tfal NL kinderarbeid PL praca dzieci PT trabalho infantil RO muncă copiilor SK detská práca SL delo otrok SV barnarbete NO barnearbeid KA ბავშვის შრომა UK дитяча праця HY 102 մանկական աշխատանք Definition(s) Any work performed by a child which deprives them of their childhood, their potential and their dignity, and that is harmful to their physical and mental development. Source(s) Webpage of the ILO International Programme on the Elimination of Child Labour (IPEC) Broader term(s) child Related term(s) forced labour EMN Asylum and Migration Classification 7.2 Minors and unaccompanied minors| 14.2 Economic factors and impacts (such as brain drain/gain, employment/ unemployment, labour market, economic growth, dumping) Euro Voc Classification 44 Employment and Working Conditions Note(s) 1. The definition does allow for a child to work (e.g. in a shop outside school hours) as long as it does not conflict with the above. It refers to work that is mentally, physically, socially or morally dangerous and harmful to children and interferes with their schooling by: ƒ depriving them of the opportunity to attend school; ƒ obliging them to leave school prematurely; or requiring them to combine school attendance with excessively long and heavy work. 2. The ILO Convention No 138 specifies 15 years as the age above which, in normal circumstances, a person may participate in economic activity. According to Art. 32 of the Charter of Fundamentals Rights of the European Union, the employment of children is prohibited. The minimum age of admission to employment may not be lower than the minimum school-leaving age, without prejudice to such rules as may be more favourable to young people and except for limited derogations. 3. Not all work done by children should be classified as child labour that is to be targeted for elimination. The ILO distinguishes between ‘child work’ and ‘child labour’, the latter being used to describe the more pejorative part of ‘child work’, whereas child work’ in itself could include doing light household chores and, as long as it does not affect their health and personal development or interfere with their schooling, can actually have some learning value. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
child’s best interests assessment (BIA) BG оценка на висшия интерес на детето CS posouzení nejlepšího zájmu dítěte EL Αξιολόγηση υπέρτερου συμφέροντος του παιδιού (ΒΙΑ) (EL); εκτίμηση βέλτιστου συμφέροντος του παιδιού (ΒΙΑ) (CY) EN child’s best interests assessment (BIA) BIA child’s best interests assessment best interests of the child assessment FR évaluation de l’intérêt supérieur de l’enfant GA measúnú um am leas is fearr do leanbh HR procjena najboljeg interesa djeteta HU a gyermek mindenek felett álló érdekének vizsgálata / a gyermek mindenek felett álló érdekének értékelése IT Valutazione del superiore interesse del minore LT geriausių vaiko interesų vertinimas LV bērna interešu novērtējums PT avaliação do superior interesse da criança RO evaluarea interesului superior al copilului / evaluarea interesului superior (BIA) UK оцінка найкращих інтересів дитини (ОНІ) HY best interests of the child (BIC) G H I L Related term(s) child’s best interests determination (BID) United Nations Convention on the Rights of the Child (UNCRC) M N O Euro Voc Classification PL ocena najlepszego interesu / ocena najlepszego interesu dziecka F K Broader term(s) 7.2 Minors and unaccompanied minors NL beoordeling van het belang van het kind E J EMN Asylum and Migration Classification MT valutazzjoni tal-aħjar interessi tat-tfal KA ბავშვის საუკეთესო ინტერესების შეფასება An ongoing procedure undertaken in each individual case which evaluates and balances all elements necessary to make a decision in a specific situation for a specific child or group of children to ensure that such procedure gives a primary consideration to the best interests of the child (BIC). Synonym(s) FI lapsen edun arviointi NO vurdering av barnets beste D Derived by EMN from UNHCR: Guidelines on Determining the best interest of the child, 2008 ET lapse parimate huvide hindamine SV hänsyn till barnets bästa C Source(s) ES evaluación del interés superior / evaluación del interés superior del niño SL ocena največje koristi otroka B Definition(s) DE Bewertung des besten Interesses des Kindes SK posúdenie najlepšieho záujmu dieťaťa A 2806 family| 2811 migration P Note(s) Q The best interests assessment is part of a continuous process in which the best interests of the child (BIC) are pursued continuously as the overall goal of any interventions made on behalf of an unaccompanied or separated child. It is essential before any action affecting an individual child is taken, unless a child’s best interests determination (BID) is needed. It does not require any particular formality, and should be conducted systematically in many circumstances that occur between the moment a child is identified as unaccompanied or separated or otherwise at risk, until a durable solution is implemented. The assessment can be done either alone or in consultation with others. It does not require the strict procedural safeguards of a formal determination, but staff should have the requisite skills and knowledge throughout the displacement cycle. երեխայի լավագույն շահերի գնահատում R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 103
child’s best interests determination (BID) BG определяне на висшия интерес на детето CS určení nejlepšího zájmu dítěte DE Bestimmung des Kindeswohls / Feststellung des Kindeswohls EL Καθορισμός υπέρτερου συμφέροντος του παιδιού (ΒΙD) (EL); BIC, καθορισμός βέλτιστου συμφέροντος του παιδιού (ΒΙD) (CY) EN child’s best interests determination (BID) ES determinación del interés superior (DIS) / determinación del interés superior del niño ET lapse parimate huvide määramine FI lapsen edun määrittäminen FR détermination de l’intérêt supérieur de l’enfant GA cinneadh um an leas is fearr do leanbh HR određivanje najboljeg interesa djeteta Definition(s) A formal process with strict procedural safeguards and documentation requirements designed to determine the best interests of the child (BIC) for particularly important decisions affecting the child and which should facilitate adequate child participation without discrimination, involve decision-makers with relevant areas of expertise, and balance all relevant factors in order to assess the best option. Source(s) UNHCR: Guidelines on Determining the best interest of the child, 2008. Synonym(s) BIC child’s best interests determination best interests of the child determination HU a gyermek mindenek felett álló érdekének meghatározása Broader term(s) IT child’s best interests determination (BID) Related term(s) LT geriausių vaiko interesų nustatymas LV bērna interešu noteikšana MT determinazzjoni tal-aħjar interessi / determinazzjoni tal‑aħjar interessi tal‑minorenni NL bepaling van het belang van het kind PL określenie najlepszego interesu / określenie najlepszego interesu dziecka PT determinação do superior interesse da criança RO determinarea interesului superior (DIS) / determinarea interesului superior al copilului SK definovanie / určenie najlepšieho záujmu dieťaťa SL določitev največje koristi otroka SV prövning av barnets bästa NO beslutning om barnets beste (b); avgjerd om barnets beste (n) KA ბავშვის საუკეთესო ინტერესების განსაზღვრა (BID) UK визначення найкращих інтересів дитини (ВНІ) HY 104 երեխայի լավագույն շահերի սահմանում best interests of the child (BIC) child’s best interests assessment (BIA) United Nations Convention on the Rights of the Child (UNCRC) EMN Asylum and Migration Classification 7.2 Minors and unaccompanied minors Euro Voc Classification 2806 family| 2811 migration Note(s) In formal child’s best interests determination (BID) processes all relevant factors are weighed and balanced giving appropriate weight to the rights and obligations recognized in the United Nations Convention on the Rights of the Child (UNCRC) and other human rights instruments, so that a comprehensive decision can be made that best protects the rights of children. A best interests determination requires stricter procedural safeguards than the assessment. The UNHCR guidelines on assessing and determining the best interests of the child 2018 require UNHCR to undertake a BID in the following three situations: ƒ the identification of the most appropriate durable solution or complementary pathway for unaccompanied children (and separated children) where there is an additional significant risk factor or protection concern); ƒ the identification of the most appropriate options for children at risk in exceptional situations; and ƒ decisions which may involve the separation of a child from parents against their will. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B circular migration BG циркулярна миграция CS cirkulární migrace C D Definition(s) DE zirkuläre Migration A repetition of legal migration by the same person between two or more countries. E EL κυκλική μετανάστευση Source(s) F EN circular migration ES migración circular ET korduvränne FI kiertomuutto European Commission Communication on Circular Migration and Mobility Partnerships, COM(2007) 248 final Related term(s) LT apykaitinė migracija brain circulation brain drain brain gain contract migrant worker diaspora mobility partnership seasonal worker LV cirkulārā migrācija FR migration circulaire GA imirce chiorclach HR kružne migracije HU körkörös migráció IT migrazione circolare G H I J K EMN Asylum and Migration Classification MT migrazzjoni ċirkolari 3. Legal Migration L NL circulaire migratie Euro Voc Classification M PL migracja cyrkulacyjna PT migração circular RO migraţie circulară SK okružná migrácia / cirkulárna migrácia SL krožna migracija SV cirkulär migration NO sirkulær migrasjon KA ცირკულარული მიგრაცია UK циркулярна міграція HY շրջանառու միգրացիա 2811 migration N Note(s) The two main forms of circular migration which could be most relevant in the EU context are: a) circular migration of third-country nationals settled in the EU This category of circular migration gives people the opportunity to engage in an activity (business, professional, voluntary or other) in their country of origin while retaining their main residence in one of the EU Member States. This covers various groups: business persons working in the EU and wishing to start an activity in their country of origin (or in another third country); and doctors, professors or other professionals willing to support their country of origin by conducting part of their professional activity there. b) circular migration of persons residing in a third country Circular migration could create an opportunity for persons residing in a third country to come to the EU temporarily for work, study, training or a combination of these, on the condition that, at the end of the period for which they were granted entry, they must re-establish their main residence and their main activity in their country of origin. Circularity can be enhanced by giving migrants the possibility, once they have returned, to retain some form of privileged mobility to and from the EU Member States where they were formerly residing, for example in the form of simplified admission / re-entry procedures. This category covers a wide array of situations, spanning the whole spectrum of migrants, including: third-country nationals wishing to work temporarily in the EU, e.g. in seasonal employment; third-country nationals wishing to study or train in Europe before returning to their country; third-country nationals who, after having completed their studies, wish to be employed in the EU (e.g. as trainees) to acquire professional experience which is difficult to obtain at home, before returning; third-country researchers wishing to carry out a research project in the EU; third-country nationals who wish to take part in intercultural people-to-people exchanges and other activities in the field of culture, active citizenship, education and youth (such as training courses, seminars, events, study visits); third-country nationals who wish to carry out an unremunerated voluntary service pursuing objectives of general interest in the EU. EMN ASYLUM AND MIGRATION GLOSSARY 10.0 105 O P Q R S T U V W X Y Z
citizenship BG гражданство CS státní občanství DE Staatsangehörigkeit / Staatsbürgerschaft EL ιθαγένεια (EL); υπηκοότητα, ιδιότητα του πολίτη (CY) EN citizenship ES nacionalidad Definition(s) The particular legal bond between an individual and their State, acquired by birth or naturalisation, whether by declaration, choice, marriage or other means according to national legislation. Source(s) ET kodakondsus Art. 2(d) of Regulation (EC) No 862/2007 (Migration Statistics Regulation) FI kansalaisuus Synonym(s) FR nationalité GA saoránacht HR državljanstvo nationality Narrower term(s) LT pilietybė acquisition of citizenship dual citizenship loss of citizenship union citizen LV pilsonība Related term(s) HU állampolgárság IT cittadinanza MT Ċittadinanza NL staatsburgerschap PL obywatelstwo PT nacionalidade RO cetăţenie SK štátne občianstvo / štátna príslušnosť SL državljanstvo SV medborgarskap NO statsborgerskap (b); statsborgarskap (n) KA მოქალაქეობა UK Громадянство HY 106 քաղաքացիություն country of nationality ethnic nationality Euro Voc Classification 1011 European Union law| 1231 international law Note(s) 1. Whilst in some EU Member States a distinction is made between citizenship and nationality, in the EU context and for the purpose of this glossary, no distinction is made and the two terms are considered to be interchangeable. In countries which distinguish between citizenship and nationality, the term citizenship refers specifically to the legal rights and duties of nationals. The European Convention on Nationality, the International Organization for Migration (IOM) Glossary and the Global Citizenship Observatory (GLOBALCIT): Glossary on Citizenship and Electoral Rights prefer the term ‹nationality›. 2. According to Art. 1 of the Hague Convention on Certain Questions Relating to the Conflict of Nationality Law, 1930 , it is for each State to determine under its own laws who are its nationals. 3. The tie of nationality confers individual rights and imposes obligations that a State reserves for its population. Nationality carries with it certain consequences as regards migration, such as the right of a State to protect its nationals against violations of their individual rights committed by foreign authorities (particularly by means of diplomatic protection), the duty to accept its nationals onto its territory, and the prohibition to expel them. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B civic orientation course BG курс по гражданска ориентация CS kurz občanské orientace EL Μαθήματα αγωγής του πολίτη EN civic orientation course ES Curso de orientación cívica ET kodanikuõpetuse kursus FI yhteiskuntaorientaatio FR cours d’éducation civique; cours d’instruction civique (LU); formation à la citoyenneté (BE); formation civique (FR) HR tečaj za građansku orijentaciju D Definition(s) DE Staatsbürgerkundekurs; Orientierungskurs (AT, DE); Staatskundekurs (LU) GA C A part of the (national) integration programmes for migrants/third-country nationals residing legally in a host country /an EU Member State which aims to convey knowledge and understanding of the fundamental values of the host country, the legal system, the residents› rights and duties, access to the labour market as well as important knowledge for everyday life which is needed to participate in society. E Source(s) I Derived by EMN from EMN AHQ on Integration measures regarding language courses and civic integration -Part 2, April 2017. Synonym(s) F G H J K LV pilsoniskās izglītības ievadkurss civic training Civic-cultural training Civic orientation course social-cultural orientation training social-cultural orientation course MT Kors t’ orjentazzzjoni ċivika Broader term(s) N EMN Asylum and Migration Classification O Euro Voc Classification P HU polgári orientációs kurzus IT corso di orientamento civico LT pilietinio orientavimo kursai NL Inburgeringsprogramma PL kurs kształtujący świadomość obywatelską PT curso de formação cívica RO curs de orientare civică SK kurzy občianskej orientácie SL tečaj državljanske vzgoje SV samhällsorienteringskurs NO samfunnsorienteringskurs KA სამოქალაქო ორიენტაციის კურსი UK курс із громадянської орієнтації HY քաղաքացիական կողմնորոշման դասընթաց L M integration programme 9.1 Integration measures 2811 migration| 2826 social affairs Q Note(s) 1. EU Member States use different approaches as to which information is conveyed during civic training and which categories of third-country nationals can benefit from civic training, to these belong among others: third country nationals/stateless persons with a residence permit for work /study purposes, applicants and beneficiaries of international protection. In some EU Member States participation is mandatory for certain groups of migrants. 2. There are also different practices in place in EU Member States whether civic orientation courses are for free, publicly funded, or participants have to pay on their own. 3. In the context of international protection, Art. 16 of Directive 2013/33/EU (Recast Reception Conditions Directive) allows EU Member States to organise vocational trainings for applicants as part of the access to the labour market. R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 107
civil partnership of convenience BG no translation CS účelové partnerství DE zivile Scheinpartnerschaft EL εικονικό σύμφωνο συμβίωσης / σύμφωνο συμβίωσης συμφέροντος EN civil partnership of convenience ES unión civil de conveniencia ET tsiviilpartnerlus (riigis seadusliku viibimise aluse saamiseks) FI harhautustarkoituksessa solmittu rekisteröity parisuhde FR partenariat civil de complaisance GA páirtnéireacht shibhialta áise HR životno partnerstvo iz koristi HU névleges élettársi kapcsolat IT unione civile fittizia LT fiktyvi registruota partnerystė Definition(s) A civil partnership contracted for the sole purpose of enabling the person concerned to enter or reside in a EU Member State. Source(s) Derived by EMN from the definition for ‘partnership’ in Art. 16(2b) of Council Directive 2003/86/EC (Family Reunification Directive) Related term(s) adoption of convenience false declaration of parenthood marriage of convenience partnership of convenience EMN Asylum and Migration Classification 6.1 Entry Conditions and Procedures Euro Voc Classification 2811 migration LV fiktīvas partnerattiecības MT Sħubija / Unjoni ċivili ta’ konvenjenza NL schijnpartnerschap PL fikcyjny związek partnerski PT parceria civil de conveniência (casamento, união de facto ou adoção) RO parteneriat (civil) de convenienta SK účelové registrované partnerstvo SL partnerska skupnost iz koristoljubja SV skenpartnerskap NO proformapartnerskap (b); proformapartnarskap (n) KA ფიქციური სამოქალაქო პარტნიორობა UK цивільне партнерство за домовленістю HY 108 պայմանական քաղաքացիական ամուսնություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B civil war refugee BG бежанец вследствие на (гражданска) война CS válečný uprchlík DE (Bürger-)Kriegsflüchtling EL πρόσφυγας εμφυλίου πολέμου EN (civil) war refugee ES refugiado por conflictos bélicos ET sõjapõgenik FI (sisällis)sotapakolainen FR réfugié de guerre (civile) GA dídeanaí cogaidh chathartha HR ratna izbjeglica HU (polgár) háborús menekült IT rifugiato a causa di una guerra (anche civile) LT pabėgėlis dėl pilietinio karo LV kara bēglis MT Rifuġjat(a) minħabba gwerra (ċivili) NL (burger)oorlogsvluchteling PL uchodźca wojenny PT refugiado de guerra RO refugiat de razboi (civil) SK utečenec z dôvodu (občianskej) vojny SL vojni begunec SV krigsflykting NO (borger)krigsflyktning (b); (borgar)krigsflyktning (n) KA (სამოქალაქო) ომის გამო ლტოლვილი UK біженець від (громадянської) війни HY քաղաքացիական պատերազմի փախստական C D Definition(s) E A person who leaves their country to escape from the effects of armed conflicts (direct effects of fighting, assaults of combat troops, displacements etc.). F Source(s) Derived by EMN from the definitions for ‘refugee’, ‘person eligible for subsidiary protection’ and ‘temporary protection’ in the EMN Glossary Synonym(s) (civil) war refugee G H I Related term(s) de facto refugee displaced person person eligible for subsidiary protection subsidiary protection temporary protection J K L EMN Asylum and Migration Classification 1. Framework Concepts on Migration (including root causes of migration M Euro Voc Classification N 2811 migration O Note(s) 1. In accordance with the EU acquis (notably Directive 2011/95/EU (Recast Qualification Directive), such a person could be granted refugee status or subsidiary protection status, depending on the grounds on which their application is based (i.e. depending on whether they were compelled to leave as a result of fear of persecution linked to a Convention ground for persecution or serious harm in the context of indiscriminate violence). 2. If there is a mass influx to the EU of such persons who have been displaced, they may also be eligible for temporary protection in accordance with Council Directive 2001/55/EC (Temporary Protection Directive). P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 109
Common Basic Principles BG Общи основни принципи CS společné základní principy DE Gemeinsame Grundprinzipien EL Κοινές Βασικές Αρχές EN Common Basic Principles ES principios básicos comunes Definition(s) In the context of EU integration policy, a set of 11 simple, non-binding but thoughtful guidelines intended to assist EU Member States in formulating their integration policies. Source(s) FI yhteiset perusperiaatteet Derived by the EMN from the European Website on Integration and JHA Council Conclusions of 19 November 2004 FR principes de base communs Synonym(s) ET ühtsed aluspõhimõtted GA comhphrionsabail bhunúsacha HR Zajednička temeljna načela Common Basic Principles for Immigrant Integration Policy HU közös alapelvek Broader term(s) IT Principi Comuni di Base LT bendrieji pagrindiniai principai LV kopīgie pamatprincipi MT Prinċipji Bażiċi Komuni NL gemeenschappelijke basisprincipes PL Wspólne Podstawowe Zasady PT princípios básicos comuns RO principii comune de bază SK spoločné základné princípy / spoločné základné zásady SL skupna temeljna načela SV gemensamma grundprinciper NO felles grunnleggende prinsipper (b); Felles grunnleggjande prinsipp (n) KA საერთო ძირითადი პრინციპები UK Загальні базові принципи HY 110 Ընդհանուր Հիմնական Սկզբունքներ integration Related term(s) host society National Contact Points on Integration EMN Asylum and Migration Classification 9.1 Integration measures Euro Voc Classification 1011 European Union law| 2811 migration| 2826 social affairs Note(s) 1. The Common Basic Principles for Immigrant Integration Policy in the EU were adopted by the Justice and Home Affairs Council in November 2004 and form the foundations of EU initiatives in the field of integration. 2. The Common Basic Principles offer a guide for EU Member States against which they can judge and assess their own efforts. They can also use these basic principles to set priorities and further develop their own measurable goals. The principles are relevant both for EU Member States with considerable experience of substantial immigration as well as for those that have more recently become destinations for significant numbers of immigrants. 3. For more information, see the EU website on integration. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
Common European Asylum System (CEAS) BG Обща европейска система за убежище CS Společný evropský azylový systém DE Gemeinsames Europäisches Asylsystem (GEAS) EL Κοινό Ευρωπαϊκό Σύστημα Ασύλου EN Common European Asylum System (CEAS) ES Sistema Europeo Común de Asilo ET Euroopa ühtne varjupaigasüsteem FI Euroopan yhteinen turvapaikkajärjestelmä FR régime d’asile européen commun (RAEC) GA Comhchóras Tearmainn Eorpach HR Zajednički europski sustav azila (CEAS) HU Közös Európai Menekültügyi Rendszer (KEMR) IT Sistema europeo comune di asilo LT Bendra Europos prieglobsčio sistema LV Kopējā Eiropas patvēruma sistēma (KEPS) MT Sistema Ewropea Komuni għall-Ażil D KA თავშესაფრის ერთიანი ევროპული სისტემა (CEAS) UK Загальноєвропейська система надання притулку (CEAS) HY Ապաստանի ընդհանուր եվրոպական համակարգ G H I Synonym(s) K CEAS L Related term(s) M N O 1011 European Union law| 2811 migration SL Skupni evropski azilni sistem NO Det felles europeiske asylsystemet F J Derived by EMN from Art. 78 of TFEU Euro Voc Classification SV det gemensamma europeiska asylsystemet E Source(s) RO Sistemul European Comun de Azil (SECA) SK Spoločný európsky azylový systém (CEAS) C A framework of agreed rules which establish common procedures for international protection and a uniform status for those who are granted refugee status or subsidiary protection status based on the full and inclusive application of the Geneva Refugee Convention and Protocol and which aims to ensure fair and humane treatment of applicants for international protection, to harmonise asylum systems in the EU and reduce the differences between Member States on the basis of binding legislation, as well as to strengthen practical cooperation between national asylum administrations and the external dimension of asylum. PT Sistema Europeu Comum de Asilo PL Wspólny Europejski System Azylowy B Definition(s) Eurasil European Union Agency for Asylum (EUAA) Lisbon Treaty minimum standards NL Gemeenschappelijk Europees Asielstelsel A P Note(s) According to Art. 78 of Treaty of the Functioning of the European Union, the Common European Asylum System shall comprise: (a) a uniform status of asylum for nationals of third countries, valid throughout the European Union; (b) a uniform status of subsidiary protection for nationals of third countries who, without obtaining European asylum, are in need of international protection; (c) a common system of temporary protection for displaced persons in the event of a massive inflow; (d) common procedures for the granting and withdrawing of uniform asylum or subsidiary protection status; (e) criteria and mechanisms for determining which Member State is responsible for considering an application for asylum or subsidiary protection; (f) standards concerning the conditions for the reception of applicants for asylum or subsidiary protection; (g) partnership and cooperation with third countries for the purpose of managing inflows of people applying for asylum or subsidiary or temporary protection. Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 111
Common Security and Defence Policy (CSDP) BG достъп до производство за международна закрила CS Společná bezpečnostní a obranná politika DE Gemeinsame Sicherheits- und Verteidigungspolitik EL Κοινή Πολιτικής Ασφαλείας και Άμυνας (ΚΠΑΑ) EN Common Security and Defence Policy (CSDP) ES Política común de seguridad y defensa ET ühine julgeoleku- ja kaitsepoliitika Definition(s) Policy offering a framework for cooperation between EU Member States within which the EU can conduct operational missions with the aim of peace-keeping and strengthening international security in third countries by relying on civil and military assets provided by EU Member States. Source(s) FI Yhteinen turvallisuus- ja puolustuspolitiikka The Security and Defence Policy on the Website of the European Union External Action Services FR politique de sécurité et de défense commune (PSDC) Synonym(s) GA Comhbheartas Slándála agus Cosanta CSDP HR Zajednička sigurnosna i obrambena politika (ZSOP) Euro Voc Classification HU közös biztonság- és védelempolitika (KBVP) IT Politica di sicurezza e di difesa comune LT Bendra saugumo ir gynybos politika LV Kopējās drošības un aizsardzības politika MT Politika ta’ Sigurtà u ta’ Difiża Komuni NL Gemeenschappelijk Veiligheids- en Defensiebeleid PL Wspólna Polityka Bezpieczeństwa i Obrony PT Política Comum de Segurança e Defesa RO Politica de securitate și apărare comună (PSAC) SK Spoločná bezpečnostná a obranná politika (SBOP) 10 European Union Note(s) 1. The Common Security and Defence Policy (CSDP) replaces the former European Security and Defence Policy (ESDP) and was introduced by the Lisbon Treaty as an integral part of the Common Foreign and Security Policy (CFSP). 2. As in the preceding Treaties, the CSDP remains a fundamentally intergovernmental issue. 3. The European Agenda on Migration of May 2015 envisages CSDP operations in the Mediterranean to dismantle traffickers’ networks and fight smuggling of migrants in accordance with international law. For further information see the DG Migration and Home Affairs website, webpage on the European Agenda on Migration. SL Skupna varnostna in obrambna politika SV gemensam säkerhets- och försvarspolitik (GFSP) NO Felles sikkerhets- og forsvarspolitikk (b); felles tryggleiks- og forsvarspolitikk KA უსაფრთხოებისა და თავდაცვის ერთიანი პოლიტიკა (CSDP) UK Спільна політика безпеки та оборони (CSDP) HY 112 Անվտանգության և պաշտպանության ընդհանուր քաղաքականություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B community sponsorship BG C D Definition(s) CS komunitní sponzorství E ES apoyo de la comunidad Programme offering a complementary legal pathway to resettlement for refugees in need of international protection in which responsibilities are shared between the government, civil society organizations and local communities who provide financial, social and/or emotional support in order to facilitate their integration in the host country. ET kogukonna sponsorlus Source(s) H DE community sponsorship (no usual translation) / gemeinschaftliche Förderung EL χορηγία από την κοινότητα υποδοχής EN community sponsorship F G HR sponzorstvo zajednice Derived by EMN from European Parliament: Briefing on community sponsorship schemes under the New Pact on Migration and Asylum, 2021 and Caritas Europe and ICMC Europe: Fostering community sponsorships across Europe, 2019 HU Közösségi szponzoráció Synonym(s) FI yhteisölähtöinen kotoutuminen FR parrainage communautaire GA urraíocht phobail IT LV kopienu sponsorēšana community-based sponsorship community sponsorship programme sponsorship MT Sponsorship Kommunitarju / Għajnuna Kommunitarja LT bendruomenės rėmimo programa I J K L EMN Asylum and Migration Classification NL community sponsorship 2. Legal and Political Framework of Migration M PL sponsoring prywatny Euro Voc Classification N PT patrocínio comunitário RO SK komunitné sponzorstvo SL skupnostno sponzorstvo SV ideellt sponsorprogram NO community sponsorship program KA სათემო სპონსორობა/მხარდაჭერა UK спонсорство громади HY Համայնքի հովանավորություն 2811 migration O Note(s) 1. There is no uniform or settled definition of the concept of community sponsorship (also known as private sponsorship). 2. Such sponsorship programmes complement traditional, state-driven resettlement programmes and sometimes overlap with them. They provide tailor-made support for the integration of refugees. 3. Canada was the first country offering community sponsorships, the Private Sponsorship of Refugees Programme (PSR) has been ongoing since 1978. 4. To ensure a more predictable and fair system of responsibility-sharing among EU Member States, the European Union has committed to the implementation of the Global Compact on Refugees (2018) and to increase the number of resettlement spaces and complementary pathways for refugees. As part of its New Pact on Asylum and Migration of September 2020, the European Commission acknowledged the growing relevance of community sponsorship as a legal migration instrument and called for a distinctly “European model of community sponsorship’ to implement community/private sponsorship programmes with EUAA support and EU funding. However, this model remains vague as to the details and the design and implementation of community sponsorship programmes remain in the responsibility of the EU Member States where different concepts are implemented that often have overlaps with resettlement, humanitarian visas, and family reunification programmes. 5. For more information see: Duken C. and Rasche L.: Towards a European Model for Community Sponsorship, March 2021, and Private Sponsorships for integration: building a European model, December 2020, and Study on the feasibility and added value of sponsorship schemes as a possible pathway to safe channels for admission to the EU, including resettlement, final report, October 2018. P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 113
complementary pathway for admission to third countries BG допълнителна възможност за прием в трети държави CS doplňková cesta pro přijetí do třetích zemí DE Komplementärer Zugangsweg für die Zulassung in Drittstaaten (EU acquis); Ergänzender Weg für die Zulassung in Drittstaaten EL συμπληρωματική οδός εισδοχής σε τρίτες χώρες EN complementary pathway for admission to third countries ES ET Kolmandatesse riikidesse vastuvõtmise täiendavad rändeteed FI täydentävä maahanmuuton väylä kolmansiin maihin FR voie d’admission complémentaire dans les pays tiers GA conair chomhlántach um ligean isteach i dtríú tíortha HR komplementarni putevi za prihvat u trećim zemljama HU kiegészítő útvonal a harmadik országokba történő befogadáshoz IT percorso complementare per l’ammissione in paesi terzi Definition(s) In the global context, safe and regulated avenues for refugees by providing legal admission and lawful stay in a third country where their international protection needs are met which complement resettlement but not substitute the protection afforded to refugees under the international protection regime, while also being able to support themselves and reach sustainable and lasting solutions for resettlement or legal stay. Source(s) Derived by EMN from UNHCR: Complementary Pathways for Admission to third countries and UNHCR: Complementary Pathways for Admission of Refugees to Third Countries: Key Considerations, April 2019. Synonym(s) complimentary pathway for refugee admission complementary pathway for admission of refugees to third countries Related term(s) LT papildomas priėmimo į trečiąsias šalis būdas legal pathway LV papildu iespējas uzņemšanai trešā valstī EMN Asylum and Migration Classification MT Mogħdija komplimentarja għad-dħul f’pajjiżi terzi 4. International Protection and other Types of Protection NL Complementaire toegangsmogelijkheid tot derde landen 2811 migration Euro Voc Classification PL uzupełniająca ścieżka przyjmowania (uchodźców) do państw trzecich PT vias complementares para a admissão em países terceiros RO cale complementară de intrare pe teritoriul țărilor terțe SK doplnkové možnosti prijímania tretími krajinami SL dopolnilna pot za sprejem v tretje države SV kompletterande inreseväg till tredje land NO lovlig adgang til tredjeland (b); lovleg tilgang til tredjeland (n) KA მესამე ქვეყნებში დაშვების დამხმარე გზა UK додатковий шлях допуску до третіх країн HY 114 երրորդ երկրներ ընդունելության լրացուցիչ ճանապարհ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. Complementary pathways offer refugees with alternatives to resorting to irregular means and harmful onward movement. They can also facilitate the acquisition and retention of skills that can help refugees attain a sustainable and lasting solution for resettlement or legal stay in the future. They may include existing admission avenues but which may require operational adjustments to facilitate refugee access. 2. Complementary pathways can be seen as an expression of global solidarity and international cooperation and a contribution to more equitable responsibility sharing. UNHCR points out that they must be carefully designed and implemented in such a way that the rights of refugees (e.g. the non-refoulement principle) and continuing international protection needs are safeguarded. 3. Current complementary pathways include humanitarian admission programs, medical evacuation, family reunification, private sponsorship, and opportunities for labour mobility and education. A key characteristic is that they typically require refugees to meet particular eligibility criteria apart from their refugee status. Three types of complementary pathways can be differentiated: humanitarian-based complementary pathways include humanitarian admission programs, humanitarian visas, and family reunification skill-based complementary pathways include opportunities for migration on the basis of employment and education, including labour mobility and educational scholarships and visas and community-based complementary pathway include private or community-based sponsorship initiatives through which citizens, community groups, or other non-profit organizations can agree to sponsor a refugee upon their arrival in a third country. For more information see IOM Glossary on Migration 2019 and Church World service (CWS): The Future of Refugee Resettlement and Complementary Pathways, Oct. 2020. 4. A particular feature of complementary pathways is that refugees can access them directly, making use of publically available information and existing administrative mechanisms, and thus securing their own solutions. 5. The Global Compact for Migration calls upon States to enhance availability and flexibility of pathways for regular migration in a way that facilitates labour mobility and decent work reflecting demographic and labour market realities, optimizes education opportunities, upholds the right to family life, and responds to the needs of migrants in a situation of vulnerability (Objective 5 of the Global Compact for Safe, Orderly and Regular Migration). F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 115
content of international protection BG съдържание на международната закрила CS obsah mezinárodní ochrany DE Inhalt des internationalen Schutzes EL περιεχόμενο της διεθνούς προστασίας EN content of international protection ES ET rahvusvahelise kaitse sisu FI kansainvälisen suojelun sisältö FR contenu de la protection internationale Definition(s) In the global context, a range of rights and benefits afforded to Convention refugees in accordance with the Geneva Refugee Convention and Protocol and international refugee and human rights law. In the EU context, a range of rights and benefits afforded to beneficiaries of international protection in accordance with Chapter VII of Directive 2011/95/EU (Recast Qualification Directive). Source(s) HU A nemzetközi védelem tartalma Global context: Derived by EMN from the Geneva Refugee Convention and Protocol EU-context: Chapter VII of Directive 2011/95/EU (Recast Qualification Directive). IT contenuto della protezione internazionale Narrower term(s) GA raon nithe cosanta idirnáisiúnta HR sadržaj međunarodne zaštite LT tarptautinės apsaugos pobūdis LV starptautiskās aizsardzības saturs MT Kontenut (Il-) tal-protezzjoni internazzjonali NL kenmerken van de internationale bescherming PL zakres ochrony międzynarodowe PT conteúdo da proteção internacional RO conținut al protecției internaționale SK obsah medzinárodnej ochrany SL vsebina mednarodne zaščite SV innebörden av internationellt skydd NO rettigheter og goder for personer med flyktningstatus (b); rettar og gode for personar med flyktningstatus (n) KA საერთაშორისო დაცვის შემადგენლობა UK зміст міжнародного захисту HY 116 միջազգային պաշտպանության բովանդակություն access to education access to employment access to healthcare access to procedures for recognition of qualifications access to social welfare family reunification right to free movement EMN Asylum and Migration Classification 4.1 International protection Euro Voc Classification 1011 European Union law| 2811 migration Note(s) 1. At EU-level, Chapter VII of Directive 2011/95/EU (Recast Qualification Directive) grants the following rights to beneficiaries of international protection: ƒ the issuance of residence permits and travel documents; ƒ the right to free movement across the national territory; ƒ the right to family reunification; ƒ access to employment; ƒ access to education and vocational training and; ƒ access to integration support and social assistance/welfare. 2. Overall, since the adoption of the Recast Qualification Directive, the rights and benefits to both beneficiaries of refugee and subsidiary protection status are the same. However, some differentiation has been made, in recognition of the primacy of the Geneva Refugee Convention and Protocol and the premise of the more temporary nature of the subsidiary protection status, subsidiary protection beneficiaries are entitled to less generous rights than refugees, i.e. with regard to the duration of residence permits, the issuance of travel documents and the access to social welfare. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B contract migrant worker BG работник мигрант на трудов договор CS pracující migrant se smluvním vztahem DE Vertragsarbeitnehmer EL μισθωτός μετανάστης εργαζόμενος EN contract migrant worker ES No translation ET lepinguline võõrtöötaja FI sopimussiirtotyöntekijä (not in general use) FR travailleur migrant sous contrat GA oibrí imirceach ar conradh HR ugovorni radnik migrant HU szerződéssel rendelkező / szerződéses migráns munkavállaló IT lavoratore migrante a contratto LT migrantas darbuotojas pagal sutartį LV līgumdarbinieks migrants MT Migrant ħaddiem b’kuntratt tax-xogħol NL buitenlandse contractarbeider PL migrant / pracownik kontraktowy PT trabalhador migrante por conta de outrem RO lucrător migrant cu contract / lucrător contractual migrant C D Definition(s) Person working in a country other than their own under contractual arrangements that set limits on the period of employment and on the specific job held by the migrant. E Source(s) G Synonym(s) H Broader term(s) I Related term(s) J OECD Glossary of Statistical Terms contract worker migrant worker circular migration seasonal worker F K EMN Asylum and Migration Classification L 3.1 Migration for Economic Purposes Euro Voc Classification 2811 migration| 4406 employment M Note(s) N 1. Contract migrant workers cannot change jobs without permission granted by the authorities of the receiving state. 2. This full term is not commonly used; ‘contract worker’, which does not necessarily apply to migrants only, is more common. O P SK pracujúci migrant so zmluvou na dobu určitú SL pogodbeni delavec migrant SV migrant med begränsat anställningsavtal Q NO migrant med begrenset arbeidsavtale (b); migrant med avgrensa arbeidsavtale (n) R KA ხელშეკრულებით დასაქმებული შრომითი S მიგრანტი UK трудовий мігрант, який працює на підставі трудового договору (контракту) HY T պայմանագրով աշխատող միգրանտ U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 117
Convention grounds for persecution BG основания за преследване, посочени в Конвенцията за статута на бежанците Definition(s) EL λόγοι δίωξης σύμφωνα με τη Σύμβαση της Γενεύης The five enumerated grounds listed in Art. 1A(2) of the Geneva Refugee Convention and Protocol: race, religion, nationality, membership of a particular social group or political opinion which must be the reason for persecution. EN Convention grounds for persecution Source(s) CS důvody pronásledování podle Ženevské úmluvy DE Verfolgungsgründe (nach) der Genfer Konvention / Konventionsgründe ES motivos de persecución Convenio de Ginebra de 1951 y Protocolo de 1967 Derived by EMN from Art. 1A(2) of the Geneva Refugee Convention and Protocol ET Genfi konventsioonis sätestatud tagakiusamise alused Synonym(s) FI Geneven yleissopimuksen mukaiset vainon perusteet grounds for persecution reasons for persecution FR motifs de persécution au sens de la Convention de Genève Broader term(s) GA forais ghéarleanúna de réir Choinbhinsiún na Ginéive Related term(s) HR Konvencijske osnove proganjanja persecution HU a Genfi Egyezmény szerinti üldöztetési ok Geneva Refugee Convention and Protocol refugee IT cause di persecuzione ex Convenzione di Ginevra EMN Asylum and Migration Classification LT persekiojimo pagrindai pagal Konvenciją 4.1.1 Refugee protection LV Ženēvas konvencijas noteiktie vajāšanas pamati Euro Voc Classification MT Motivi għall-persekuzzjoni skont il-Konvenzjoni ta’ Ġinevra 1231 international law| 2811 migration NL gronden voor vervolging in de zin van het Vluchtelingenverdrag Note(s) PL przesłanki konwencyjne związane z prześladowaniem PT motivos de perseguição na aceção da Convenção de Genebra RO motive de persecutie stabilite de Conventia de la Geneva SK dôvody prenasledovania podľa Ženevského dohovoru SL konvencijski razlogi za preganjanje / razlogi za preganjanje po Ženevski konvenciji SV konventionsgrunder för förföljelse NO konvensjonsgrunnene for forfølgelse (b); konvensjonsgrunnane for forfølging (n) KA კონვენციით განსაზღვრული დევნის საფუძვლები UK Підстави для переслідування за Конвенцією HY 118 Կոնվենցիայով սահմանված հետապնդման հիմքեր 1. Not every person who is outside their own country and has a well-founded fear of persecution is a Convention refugee. One of the conditions for qualification for refugee status within the meaning of Art. 1(A) of the Geneva Refugee Convention is the existence of a causal link between the reasons for persecution, namely race, religion, nationality, political opinion or membership of a particular social group, and the acts of persecution or the absence of protection against such acts. Persecution based on any other ground will not be considered. The risk of being persecuted may sometimes arise in circumstances where two or more Convention grounds combine in the same person, in which case the combination of such grounds defines the causal connection to the well-founded fear of being persecuted. 2. The following definitions come into play when States attempt to determine who is and who is not a refugee: ƒ race is used in its broadest sense and includes ethnic and social groups of common descent; ƒ religion also has meaning, including identification with a group that tends to share common traditions or beliefs, as well as the active practice of religion; ƒ nationality includes an individual’s citizenship. Persecution of ethnic, linguistic and cultural groups within a population also may be termed persecution based on nationality; ƒ a particular social group refers to people who share a similar background, habits or social status. This category often overlaps with persecution based on one of the other four grounds. It has applied to families of capitalists, landowners, homosexuals, ƒ political opinion refers to ideas not tolerated by the authorities, including opinions critical of government policies and methods. It includes opinions attributed to individuals even if the individual does not in fact hold that opinion. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B Convention refugee BG бежанец съгласно Конвенцията за статута на бежанците от 1951 г. C D Definition(s) CS azylant / uprchlík podle Úmluvy DE Konventionsflüchtling EL πρόσφυγας σύμφωνα με τη Σύμβαση της Γενεύης EN Convention refugee ES refugiado (en términos de la Convención de Ginebra) ET konventsioonipagulane Person recognised as a refugee by States under the criteria in Art. 1A of the Geneva Refugee Convention and Protocol, and entitled to the enjoyment of a variety of rights under that Convention. E Source(s) G Derived by EMN from the UNHCR Master Glossary of Terms H Synonym(s) FI Geneven yleissopimuksen mukainen pakolainen recognised refugee FR réfugié au sens de la Convention de Genève I Broader term(s) GA dídeanaí de réir Choinbhinsiún na Ginéive beneficiary of international protection HR konvencijska izbjeglica J Related term(s) HU konvenciós menekült LT pabėgėlis pagal Konvenciją mandate refugee refugee status relocation LV bēglis Ženēvas konvencijas izpratnē EMN Asylum and Migration Classification IT rifugiato ex Convenzione di Ginevra MT Rifuġjat(a) skont il-Konvenzjoni ta’ Ġinevra K L M 4.1.1 Refugee protection NL verdragsvluchteling Euro Voc Classification PL uchodźca konwencyjny F N 1231 international law| 2811 migration PT refugiado (na aceção da Convenção de Genebra de 1951 relativa aos refugiados) O RO refugiat în sensul Convenției privind statutul refugiaților / refugiat în baza convenţiei de la Geneva P SK utečenec podľa Ženevského dohovoru SL konvencijski begunec / begunec po Ženevski konvenciji Q SV konventionsflykting R NO konvensjonsflyktning KA ლტოლვილი კონვენციის საფუძველზე S UK біженець за Конвенцією про статус біженців 1951 року T HY Կոնվենցիայով ճանաչված փախստական U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 119
Cooperation Platform on Migration and Development BG Платформа за сътрудничество по въпросите на миграцията и развитието Definition(s) EL Πλατφόρμα Συνεργασίας για θέματα Μετανάστευσης και Ανάπτυξης A concept in the framework of the Global Approach to Migration and Mobility (GAMM) whichs bring together migration and development actors in a country or region to manage migration more effectively, in the interests of all, along specific migration routes. EN Cooperation Platform on Migration and Development Source(s) CS Platforma pro spolupráci - migrace a rozvoj DE Kooperationsplattform für Migration und Entwicklung ES Plataforma de Cooperación sobre Migración y Desarrollo ET rände ja arenguabi koostööplatvorm FI muuttoliikettä ja kehitystä käsittelevä yhteistyöfoorumi FR Plate-forme de coopération sur la migration et le développement GA Clár Comhoibrithe um Imirce agus Fhorbairt HR Platforma za suradnju u području migracija i razvoja HU Együttműködési platform a migráció és fejlesztés területén IT Piattaforma di cooperazione sulla migrazione e lo sviluppo LT Migracijos ir vystymosi bendradarbiavimo platforma LV sadarbības platforma par migrāciju un attīstību MT Pjattaforma ta’ Kooperazzjoni fuq il-Migrazzjoni u l-Iżvilupp NL samenwerkingsplatform voor migratie en ontwikkeling PL Platforma Współpracy na rzecz Migracji i Rozwoju PT Plataforma de Cooperação em matéria de Migração e de Desenvolvimento RO Platforma de cooperare cu privire la Migratie si dezvoltare SK Platforma spolupráce v oblasti migrácie a rozvoja Derived by EMN from Annex I of the European Commission Communication on the Global Approach to Migration, COM(2006) 735 final and the European Commission Communication on the Global Approach to Migration and Mobility, COM(2011) 743 final Synonym(s) cooperation platform Broader term(s) Global Approach to Migration and Mobility (GAMM) Related term(s) Global Forum on Migration and Development (GFMD) migration profile migration routes initiative mobility partnership EMN Asylum and Migration Classification 15.1 EU External dimension of migration and mobility Euro Voc Classification 04 Politics| 2811 migration Note(s) 1. This concept was proposed in the 2006 Communication on the Global Approach COM(2006) 735 and endorsed by the December 2006 European Council. 2. Such platforms bring together representatives of the country or countries concerned with EU Member States, the Commission and international organisations. SL Platforma za sodelovanje na področju migracij in razvoja SV samarbetsplattform för migration och utveckling NO Samarbeidsplattform om migrasjon og utvikling KA მიგრაციისა და განვითარების საკითხებზე თანამშრომლობის პლატფორმა UK Платформа для співпраці з питань міграції та розвитку HY 120 Միգրացիայի և Զարգացման համագործակցության հարթակ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B Cotonou Agreement BG Споразумението от Котону CS Dohoda z Cotonou DE Cotonou-Abkommen EL Συμφωνία Κοτονού EN Cotonou Agreement ES Acuerdo de Cotonou ET Cotonou leping FI Cotonoun sopimus FR Accord de Cotonou GA Comhaontú Cotonou HR Sporazum iz Cotonoua HU Cotonoui Megállapodás IT Accordo di Cotonou LT Kotonu susitarimas The Partnership Agreement between the members of the African, Caribbean and Pacific (ACP) Group of States of the one part and the European Union and its Member States of the other part, in order to promote and expedite the economic, cultural and social development of the ACP States, with a view to contributing to peace and security and to promoting a stable and democratic political environment. Source(s) Synonym(s) SV Cotonouavtalet NO Cotonou-avtalen KA კოტონუს შეთანხმება UK Котонуська угода HY Կոտոնուի համաձայնագիր H Related term(s) K L M 15.1 EU External dimension of migration and mobility Euro Voc Classification 04 Politics N Note(s) O RO Acordul Cotonou SL Sporazum iz Cotonouja G J EMN Asylum and Migration Classification SK Dohoda z Cotonou F ACP-EC Partnership Agreement Cotonou Partnership Agreement LV Kotonū nolīgums PT Acordo de Cotonou E I Cotonou Agreement MT Ftehim (Il-) ta’ Cotonou PL Porozumienie z Cotonou D Definition(s) Global Approach to Migration and Mobility (GAMM) Global Forum on Migration and Development (GFMD) NL Overeenkomst van Cotonou C 1. The Cotonou Agreement is the most comprehensive Partnership Agreement between developing countries and the EU. It was signed on 23 June 2000 in Cotonou, Benin as a global agreement, introducing important changes and ambitious objectives while preserving the ‘acquis’ of 25 years of ACP-EC cooperation. It was revised in Luxembourg on 25 June 2005. 2. Art. 13 of this agreement refers to the issue of migration which shall be the subject of in-depth dialogue in the framework of the ACP-EU Partnership. 3. For more information, see the description of the Agreement on the EuropeAid website. P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 121
country of birth BG страна на раждане CS země narození DE Geburtsland EL χώρα γέννησης EN country of birth ES país de nacimiento ET sünniriik Definition(s) The country of residence (in its current borders, if the information is available) of the mother at the time of the birth or, in default, the country (in its current borders, if the information is available) in which the birth took place. Source(s) FI syntymämaa Art.2(e) of Regulation (EC) No 862/2007 (Migration Statistics Regulation) FR pays de naissance Related term(s) HR država rođenja country of nationality country of origin HU születés helye szerinti ország EMN Asylum and Migration Classification GA tír bhreithe IT paese di nascita LT šalis, kurioje gimė (EU acquis); gimimo valstybė LV dzimšanas valsts 14. Factors and Impacts of Migration Euro Voc Classification 12 Law| 2816 demography and population MT Art (L-) tat twelid NL geboorteland PL kraj urodzenia PT país de nascimento RO ţara de naştere SK krajina narodenia SL država rojstva SV födelseland NO fødeland KA დაბადების ქვეყანა UK країна народження HY 122 ծննդավայր EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B country of destination BG страна на дестинация CS cílová země C D Definition(s) DE Zielland The country that is a destination for migration flows (regular or irregular). E EL χώρα προορισμού Source(s) EN country of destination Derived by EMN from IOM Glossary on Migration, 2019. F ES país de destino Related term(s) G FI kohdemaa country of origin country of transit FR pays de destination EMN Asylum and Migration Classification ET sihtriik GA tír cinn scríbe / iolra: tíortha ceann scríbe HR država odredišta HU célország H I 14. Factors and Impacts of Migration Euro Voc Classification J 2811 migration IT paese di destinazione K LT tikslo valstybė L LV mērķa valsts MT Pajjiż fid-destinazzjoni M NL land van bestemming PL kraj docelowy N PT país de destino RO ţara de destinaţie O SK cieľová krajina SL ciljna država P SV destinationsland NO destinasjonsland Q KA დანიშნულების ქვეყანა R UK країна призначення HY նպատակակետ երկիր S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 123
country of nationality BG страна на гражданство CS země státní příslušnosti DE Land der Staatsangehörigkeit / Land der Staatsbürgerschaft EL Χώρα της ιθαγένειας EN country of nationality ES país de nacionalidad ET kodakondsusjärgne riik FI kansalaisuusvaltio Definition(s) The country (or countries) of which a person holds citizenship. Source(s) Developed by EMN Synonym(s) state of nationality Related term(s) GA tír náisiúntachta citizenship country of birth country of origin HR zemlja državljanstva EMN Asylum and Migration Classification FR pays de nationalité HU állampolgárság szerinti ország 14. Factors and Impacts of Migration IT paese di cittadinanza Euro Voc Classification LT pilietybės valstybė LV pilsonības valsts MT Pajjiż tan-nazzjonalità NL land waarvan iemand onderdaan is / land waarvan iemand het staatsburgerschap heeft PL państwo, którego obywatelem jest cudzoziemiec 2811 migration Note(s) 1. A person may have a different country of nationality from their country of origin and / or country of birth owing, for example, to the acquisition of citizenship in a country different from their country of birth. 2. In some EU Member States, this term is used in the context of return. PT país de nacionalidade RO ţara de cetăţenie SK krajina štátneho občianstva / krajina štátnej príslušnosti SL država državljanstva SV medborgarskapsland NO statsborgerskapsland (b); statsborgarskapsland (n) KA მოქალაქეობის ქვეყანა UK країна громадянства HY 124 քաղաքացիության երկիր EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B country of origin BG страна на произход CS země původu C D Definition(s) DE Herkunftsland, Herkunftsstaat The country of nationality or, for stateless persons, of former habitual residence. E EL χώρα καταγωγής Source(s) F EN country of origin ES país de origen ET päritoluriik FI alkuperämaa/lähtömaa FR pays d’origine GA tír thionscnaimh HR zemlja podrijetla HU származási ország IT paese di origine LT kilmės šalis (EU acquis); kilmės valstybė LV izcelsmes valsts MT Pajjiż tal-oriġini NL land van herkomst PL kraj pochodzenia PT país de origem RO ţara de origine SK krajina pôvodu SL izvorna država Art. 2(n) of Directive 2011/95/EU (Recast Qualification Directive) Synonym(s) H state of origin Narrower term(s) country of origin information (COI) safe country of origin I Related term(s) J country of birth country of nationality country of return K L EMN Asylum and Migration Classification 1. Framework Concepts on Migration (including root causes of migration| 14. Factors and Impacts of Migration M Euro Voc Classification N 2811 migration O Note(s) P A person may have more than one country of origin. SV ursprungsland NO opprinnelseslandd (b); opphavsland (n) Q KA წარმომავლობის (წარმოშობის) ქვეყანა R UK країна походження HY G ծագման երկիր S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 125
country of origin information (COI) BG информация за страни на произход CS informace o zemích původu Definition(s) ES información del país de origen Information used by the EU Member States authorities to analyse the socio-political situation in countries of origin of applicants for international protection (and, where necessary, in countries through which they have transited) in the assessment, carried out on an individual basis, of an application for international protection. ET päritoluriigi info Source(s) DE Herkunftsländerinformation EL πληροφορίες για τις χώρες καταγωγής EN country of origin information (COI) FI alkuperämaatieto/lähtömaatieto FR information sur le pays d’origine GA faisnéis faoin tír thionscnaimh HR informacije o zemlji podrijetla HU származási országinformáció IT informazioni sul paese di origine LT informacija apie kilmės valstybę Derived by EMN from Annex C of Communication on Strengthened Practical Cooperation, COM(2006) 67 final and Art. 4 (3a) of Directive 2011/95/EU (Recast Qualification Directive) and Art. 10 (3b) of Directive 2013/32/EU (Recast Asylum Procedures Directive) Synonym(s) NL landeninformatie / herkomstlandeninformatie COI country information information on third countries third-country information PL informacje o kraju pochodzenia Broader term(s) LV informācija par izcelsmes valsti MT Informazzjoni dwar il-pajjiż tal-oriġini PT informação do país de origem RO informaţii din ţara de origine SK informácie o krajine pôvodu (COI) SL informacije o izvorni državi SV landinformation NO landinformasjon KA ინფორმაცია წარმომავლობის (წარმოშობის) ქვეყნის შესახებ (COI) UK інформація про країну походження (ІКП) HY ծագման երկրի մասին տեղեկատվություններ country of origin Related term(s) European Union Agency for Asylum (EUAA) EMN Asylum and Migration Classification 6.3.6 Country of origin information in migration procedures Euro Voc Classification 2811 migration| 3231 information and information processing Note(s) 1. All relevant facts as they relate to the country of origin at the time of taking a decision on the application are used. The relevant facts are obtained from various sources, such as the European Union Agency for Asylum (EUAA), United Nations High Commissioner for Refugees (UNHCR) and relevant international human rights organisations, general public sources such as reports from (inter)national organisations, governmental and non-governmental organisations, media, bilateral contacts in countries of origin, embassy reports including the laws and regulations of the country of origin and the manner in which they are applied. 2. The COI used by the EU Member States authorities is made available to the personnel responsible for examining applications and taking decisions. 3. To ensure that COI can contribute to fair and efficient procedures, certain quality standards such as ‘relevance’, ‘reliability and balance’, ‘accuracy and currency’ and ‘transparency and traceability’ have been developped. To qualify as COI it is essential that the source of the information has no vested interest in the outcome of the individual application for international protection. 4. This information is also used inter alia for taking decisions on other migration issues, e.g. on return, as well as by researchers. 5. According to Art. 9 of Regulation (EU) 2021/2303 (EUAA-Regulation), the EUAA shall be a centre for gathering relevant, reliable, objective, accurate and up-to date information on relevant third countries in a transparent and impartial manner, making use of relevant information, including child-specific and gender-specific information, and targeted information on persons belonging to vulnerable and minority groups. 126 EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B country of return BG страна на връщане CS země návratu C D Definition(s) DE Rückkehrland In the EU context, a third country to which a thirdcountry national returns. E EL χώρα επιστροφής Source(s) EN country of return Developed by EMN F ES país de retorno Related term(s) G FI paluumaa country of origin country of transit FR pays de retour Euro Voc Classification ET vastuvõttev riik GA tír fillte HR država povratka HU visszatérési ország IT paese di ritorno LT valstybė, į kurią grįžta H 2811 migration I Note(s) J 1. This is not defined in legal terms. 2. In most cases, it is the country of origin to which a return is made, but this definition is used here in order to indicate other (possible) destinations, e.g. country of transit or another third country. L LV atgriešanas valsts (EU acquis); izraidīšanas valsts MT Pajjiż fejn wieħed jirritorna / fejn w. imur lura M NL terugkeerland PL kraj powrotu N PT país de retorno RO ţara de returnare O SK krajina návratu SL država vrnitve P SV återvändandeland NO returland Q KA დაბრუნების ქვეყანა R UK країна повернення HY K վերադարձի երկիր S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 127
country of transit BG страна на транзит CS tranzitní země DE Transitland EL χώρα διέλευσης EN country of transit ES país de tránsito ET transiitriik FI kauttakulkumaa FR pays de transit Definition(s) The country through which migration flows (regular or irregular) move; this means the country (or countries), different from the country of origin, which a migrant passes through in order to enter a country of destination. Source(s) Developed by EMN Related term(s) HR država tranzita country of destination country of origin country of return HU tranzitország EMN Asylum and Migration Classification GA tír idirthurais IT paese di transito 14. Factors and Impacts of Migration LT tranzito valstybė Euro Voc Classification LV tranzītvalsts 2811 migration MT Pajjiż ta’ transitu // Pajjiż li wieħed jgħaddi minnu NL transitland / doorreisland PL kraj tranzytowy PT país de trânsito RO ţara de tranzit SK tranzitná krajina SL tranzitna država SV transitland NO transittland KA სატრანზიტო ქვეყანა UK країна транзиту HY 128 տարանցման երկիր EMN ASYLUM AND MIGRATION GLOSSARY 10.0
Court of Justice of the European Union (CJEU) BG Съд на Европейския съюз CS Soudní dvůr Evropské unie A B C D Definition(s) ES Tribunal de Justicia de la Unión Europea The judicial authority of the European Union which ensures in cooperation with the courts and tribunals of the EU Member States the uniform application and interpretation of European Union law; and which settles legal disputes between national governments and EU institutions. ET Euroopa Liidu Kohus Source(s) DE Gerichtshof der Europäischen Union (EuGH) EL Δικαστήριο της Ευρωπαϊκής Ένωσης EN Court of Justice of the European Union (CJEU) FI Euroopan unionin tuomioistuin Website of the European Union’s Curia FR Cour de justice de l’Union européenne Synonym(s) HR Sud Europske unije CJEU European Court of Justice HU Az Európai Unió Bírósága (EUB) Related term(s) GA Cúirt Bhreithiúnais an Aontais Eorpaigh IT Corte di giustizia dell’Unione europea LT Europos Sąjungos Teisingumo Teismas LV Eiropas Savienības Tiesa MT Qorti (Il-) tal-Ġustizzja tal-Unjoni Ewropea (QĠUE) NL Hof van Justitie van de Europese Unie PL Trybunał Sprawiedliwości Unii Europejskiej PT Tribunal de Justiça da União Europeia RO Curtea de Justiție a Uniunii Europene SK Súdny dvor Európskej únie (CJEU) SL Sodišče Evropske unije SV Europeiska unionens domstol (EU-domstolen) NO EU-domstolen KA ევროკავშირის მართლმსაჯულების სასამართლო (CJEU) F G H I J European Court of Human Rights (ECtHR) K Euro Voc Classification 1006 EU institutions and European civil service| 1011 European Union law L M Note(s) 1. The institution was originally established in 1952 as a single court called the Court of Justice of the European Coal and Steel Communities (as of 1958 the Court of Justice of the European Communities (CJEC)). With the entry into force of the Lisbon Treaty in 2009, the court system obtained its current name (Court of Justice of the European Union), while the court itself was renamed “Court of Justice”. 2. The Court is based in Luxembourg and consists of two courts: the Court of Justice and the General Court (created in 1988). The court has one judge per EU Member State. The governments of EU Member States agree on whom they want to appoint. 3. The Court reviews the legality of the acts of the institutions of the European Union; ensures that the EU Member States comply with obligations under the Treaties; and interprets European Union law at the request of the national courts and tribunals. UK Суд Європейського Союзу (СЄС) HY E N O P Q R S Եվրոպական միության արդարադատության դատարան (CJEU) T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 129
credibility assessment BG оценка на достоверността CS posouzení věrohodnosti Definition(s) ES evaluación de la credibilidad The process of gathering relevant information from the applicant for international protection, examining it in the light of all the information available to the case worker in procedures for international protection, for the purpose of the determination of qualification for refugee status and / or subsidiary protection status. ET usaldusväärsuse / usutavuse hindamine Source(s) DE Glaubwürdigkeitsprüfung / Prüfung der Glaubwürdigkeit EL αξιολόγηση της αξιοπιστίας EN credibility assessment FI uskottavuusarviointi FR évaluation de la crédibilité GA measúnú creidiúnachta HR utvrđivanje vjerodostojnosti HU szavahihetőség értékelése IT valutazione di credibilità LT patikimumo vertinimas LV ticamības novērtējums MT Evalwazzjoni tal-kredibilità UNHCR: Beyond proof -credibility assessment in EU asylum systems, 2013 Related term(s) real risk of suffering serious harm well-founded fear of persecution EMN Asylum and Migration Classification 6.2 Procedure for international protection/Refugee status determination Euro Voc Classification 1231 international law| 2811 migration NL beoordeling van de geloofwaardigheid PL ocena wiarygodności PT avaliação da credibilidade RO evaluarea credibilitatii SK preukazovanie dôveryhodnosti SL ocena verodostojnosti SV trovärdighetsbedömning Note(s) 1. The credibility assessment is also a step taken in adjudicating an application for a visa or other immigration status, in order to determine whether the information presented by the applicant is consistent and credible (see the definition ‹credibility assessment› in the IOM Glossary on Migration, 2019). 2. Credibility is established where the applicant has presented a claim which is coherent and plausible, not contradicting generally known facts, and therefore is, on balance, capable of being believed. NO vurdering av troverdighet (b); vurdering av truverd (n) KA სანდოობის შეფასება UK оцінка достовірності HY 130 արժանահավատության գնահատում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B crime against humanity BG престъпление срещу човечеството CS zločin proti lidskosti DE Verbrechen gegen die Menschlichkeit EL έγκλημα κατά της ανθρωπότητας EN crime against humanity ES crimen contra la humanidad ET inimsusevastane kuritegu FI rikos ihmisyyttä vastaan FR crime contre l’humanité GA coir i gcoinne an chine dhaonna HR zločin protiv čovječnosti HU emberiesség elleni bűncselekmény C D Definition(s) E Act committed as part of a widespread or systematic attack directed against any civilian population, with knowledge of the attack. F Source(s) Art. 7 of the Rome Statute of the International Criminal Court G Related term(s) H exclusion clause genocide war crime I Euro Voc Classification J 1236 rights and freedoms IT crimine contro l’umanità LT nusikaltimas žmoniškumui LV noziegums pret cilvēci MT Reat kontra l-umanità NL misdrijf tegen de menselijkheid PL zbrodnia przeciwko ludzkości PT crimes contra a humanidade RO crimă împotriva umanităţii SK zločin proti ľudskosti SL zločin proti človeštvu / zločin proti človečnosti SV brott mot mänskligheten NO forbrytelse mot menneskeheten (b); brotsverk mot menneskeslekta (n) KA დანაშაული კაცობრიობის წინააღმდეგ K Note(s) Crimes against humanity include: a) murder; b) extermination; c)enslavement; d) deportation or forcible transfer of population; e) imprisonment or other severe deprivation of physical liberty in violation of fundamental rules of international law; f) torture; g) rape, sexual slavery, enforced prostitution, forced pregnancy, enforced sterilisation, or any other form of sexual violence of comparable gravity; h) persecution against any identifiable group or collectivity on political, racial, national, ethnic, cultural, religious, gender as defined in paragraph 3, or other grounds that are universally recognised as impermissible under international law, in conn i)enforced disappearance of persons; j) the crime of apartheid; k) other inhumane acts of a similar character intentionally causing great suffering, or serious injury to body or to mental or physical health. M N O P Q R UK злочин проти людства HY L S մարդկության դեմ հանցագործություն T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 131
cross-border worker BG трансграничен работник CS přeshraniční pracovník / příhraniční pracovník DE Grenzgänger EL διασυνοριακός εργαζόμενος / μεθοριακός εργαζόμενος EN cross-border worker ES trabajador transfronterizo ET piiriülene töötaja FI rajatyöntekijä (EN cross-border worker) FR travailleur transfrontalier / travailleur frontalier GA oibrí trasteorann HR prekogranični radnik HU (tagállamok között) ingázó munkavállaló IT lavoratore frontaliero LT darbuotojas, kertantis vidaus sienas LV pārrobežu darba ņēmējs MT Ħaddiem transkonfinali / jaqsam fruntiera NL grensarbeider PL pracownik transgraniczny PT trabalhador transfronteiriço RO lucrator transfrontalier SK cezhraničný pracovník SL čezmejni delavec SV gränsarbetare NO grensependler (b); grensependlar (n) KA ტრანსსასაზღვრო მუშაკი UK транскордонний працівник HY 132 Definition(s) A person who works as an employee or self-employed person in one EU Member State but is recognised as residing in another (neighbouring) EU Member State. Source(s) Derived by EMN from the definition of ‘cross-border workers’ by DG Taxation and Customs Union (DG TAXUD) Synonym(s) cross-border commuter Related term(s) frontier worker EMN Asylum and Migration Classification 3.1 Migration for Economic Purposes Euro Voc Classification 1011 European Union law| 2811 migration| 4406 employment Note(s) 1. In dealing with cross-border issues a multitude of definitions for the term ‘cross-border worker/commuter’ exists. 2. The concept of cross-border workers covers different circumstances, depending on whether one takes the Community meaning (set out, in particular, in connection with social security) or the various definitions included in bilateral double-taxation agreements. 3. Where tax is concerned, bilateral double-taxation agreements determining the tax arrangements applicable to frontier workers use more restrictive definitions which additionally impose a spatial criterion: the fact of living and working in a frontier zone. 4. Often ‘cross-border workers’ and ‘frontier workers’ are considered as synonyms. However, cross-border workers are distinct from frontier workers to the extent that they do not necessarily work in the frontier zone of the host country. միջսահմանային աշխատող EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B crude rate of net migration BG общ коефициент на нетна миграция C D Definition(s) CS hrubá míra migračního salda DE rohe Netto-Migrationsrate The ratio of net migration plus adjustment during the year to the average population in that year. E EL ακαθάριστο ποσοστό της καθαρής μετανάστευσης Source(s) EN crude rate of net migration Eurostat’s Concepts and Definitions Database F ES tasa neta de migración Related term(s) G migration flow net migration population stock total migration ET rändesaldo määr FI nettomaahanmuutto tuhatta henkeä kohden FR taux brut de solde migratoire GA garbhráta glanimirce H I EMN Asylum and Migration Classification HR stopa neto migracije IT tasso grezzo di migrazione netta 6.3.7 Statistics in migration procedures| 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) LT neto migracija tūkstančiui gyventojų Euro Voc Classification HU nyers nettó migrációs arányszám LV migrācijas saldo vispārīgais koeficients MT Rata bejn wieħed u ieħor ta’ migrazzjoni netta / Rata netta ta’ migrazzjoni PL współczynnik salda migracji PT taxa bruta do saldo migratório RO rata brută a migrației nete L Note(s) M SK hrubá miera čistej migrácie / hrubá miera migračného salda N O P SL splošna stopnja neto migracij Q SV nettomigration NO summarisk nettomigrasjonsrate R KA მიგრაციის სალდოს ზოგადი კოეფიციენტი UK загальний коефіцієнт чистої міграції HY K 2811 migration| 2816 demography and population The value is expressed per 1,000 inhabitants. The crude rate of net migration is equal to the difference between the crude rate of increase and the crude rate of natural increase (that is, net migration is considered as the part of population change not attributable to births and deaths). It is calculated in this way because immigration or emigration flows are either unknown or the figures are not sufficiently precise. NL bruto cijfer migratiesaldo J S զուտ միգրացիայի անմշակ տոկոսը T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 133
cultural diversity BG културно многообразие CS kulturní diverzita DE kulturelle Vielfalt EL πολιτιστική ποικιλομορφία EN cultural diversity ES diversidad cultural ET kultuuriline mitmekesisus FI kulttuurinen moninaisuus FR diversité culturelle GA ilchineálacht chultúrtha HR kulturna različitost HU kulturális sokszínűség IT diversità culturale Definition(s) The diversity of forms of culture in a society composed of groups of people from many different cultural backgrounds. Source(s) Developed by EMN Related term(s) cultural pluralism EMN Asylum and Migration Classification 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) Euro Voc Classification 28 Social Questions| 2811 migration| 2831 culture and religion LT kultūrinė įvairovė LV kultūras daudzveidība MT Diversità kulturali NL culturele diversiteit PL różnorodność kulturowa PT diversidade cultural RO diversitate culturală SK kultúrna rozmanitosť / kultúrna diverzita SL kulturna raznolikost SV kulturell mångfald NO kulturelt mangfold (b); kulturelt mangfald (n) KA კულტურული მრავალფეროვნება Note(s) 1. The UNESCO Declaration on Cultural Diversity reflects the diverse and pluralist understanding of culture and defines cultural diversity in Art. 1 as follows: ‹Diverse forms of culture across time and space which is embodied in the uniqueness and plurality of the identities of the groups and societies making up humankind and is a source of exchange, innovation and creativity.’ The scope and definition agreed on in the UNESCO declaration were partly retained in the 2005 UNESCO Convention on Cultural Diversity (UNESCO Convention on the Protection and Promotion of the Diversity of Cultural Expression), the successive legally binding Convention, which is a landmark agreement in modern international law of culture and which sets out common rules, principles and points of reference for cultural diversity at the global level. 2. On 18 December 2006, the European Community ratified the UNESCO Convention. Preserving and promoting cultural diversity are among the Community’s founding principles: they are enshrined in the Treaty, under Art. 151, and in the Charter of Fundamental Rights of the European Union, under Art. 22.3. UK культурне розмаїття HY 134 մշակութային բազմազանություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B cultural mediator BG посредник за социална (и културна) ориентация CS kulturní mediátor DE interkultureller Mediator / kultureller Mediator EL πολιτιστικός διαμεσολαβητής EN cultural mediator ES Mediador cultural ET kultuurivahendaja FI kulttuurivälittäjä / kulttuuritulkki FR médiateur culturel GA idirghabhálaí cultúrtha HR kulturni medijator HU kulturális mediátor C In the migration context, a professional who facilitates the communication (including interpretation) between people speaking different languages and with different cultural backgrounds. E Source(s) G Synonym(s) H Related term(s) I EMN Asylum and Migration Classification J Developed by EMN. intercultural mediator interpreter IT mediatore culturale 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) LT kultūrinis mediatorius Euro Voc Classification LV kultūras vidutājs MT Medjatur / Bejjien kulturali NL Culturele mediator / Intercultureel bemiddelaar PL mediator kulturowy PT mediador cultural RO mediator cultural / mediator comunitar SK kultúrny mediátor SL kulturni mediator / medkulturni mediator SV kulturtolk NO kulturtolk KA კულტურათა შუამავალი UK культурний медіатор HY D Definition(s) F K 2811 migration| 2831 culture and religion L Note(s) M 1. Cultural mediators provide information on different sets of value, orientations to life, beliefs, assumptions and socio-cultural conventions by clarifying culture-specific expressions and concepts that might give rise to misunderstanding. 2. Intercultural mediation is not a registered profession; thus the role of cultural mediators is not clearly defined and acknowledged. Therefore the practice does not follow a standardized code of conduct, and it is not exercised within a certain legal framework. 3. The terms cultural mediator and intercultural mediator are used differently in EU Member States and different standards apply. 4. Cultural mediator should not be confused with the term interpreter, as intercultural mediation is a much wider and a more enriched means of communicating messages from sender to receiver than interpreting. For more information see also the entry of interpreter. N O P Q R մշակութային միջնորդ S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 135
cultural pluralism BG културен плурализъм CS kulturní pluralismus DE kultureller Pluralismus EL πολιτιστικός πλουραλισμός EN cultural pluralism ES pluralismo cultural Definition(s) A policy aimed at the ensuring of harmonious interaction among people and groups with plural, varied and dynamic cultural identities as well as their willingness to live together. Source(s) ET kultuuride paljusus Art. 2 of UNESCO Universal Declaration on Cultural Diversity FI kulttuurinen monimuotoisuus Related term(s) FR pluralisme culturel GA iolrachas cultúrtha culture cultural diversity HR kulturni pluralizam EMN Asylum and Migration Classification HU kulturális pluralizmus IT pluralismo culturale LT kultūrinis pliuralizmas LV kultūras plurālisms MT Pluraliżmu kulturali NL cultureel pluralisme PL pluralizm kulturowy PT pluralismo cultural RO pluralism cultural 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) Euro Voc Classification 2811 migration| 2831 culture and religion Note(s) 1. According to the UNESCO definition, policies for the inclusion and participation of all citizens are guarantees of social cohesion, the vitality of civil society and peace. Thus defined, cultural pluralism gives policy expression to the reality of cultural diversity. 2. See also the UNESCO Convention on the Protection and Promotion of Cultural Expressions, 2005. SK kultúrny pluralizmus SL kulturni pluralizem SV kulturell pluralism NO kulturell pluralisme KA კულტურული პლურალიზმი UK культурний плюралізм HY 136 մշակութային բազմակարծություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B culture BG култура CS kultura DE Kultur EL πολιτισμός, κουλτούρα EN culture ES cultura ET kultuur C FR culture Related term(s) HR kultura cultural diversity cultural pluralism HU kultúra EMN Asylum and Migration Classification LT kultūra LV kultūra F G Source(s) Derived by EMN from the definition in the UNESCO Universal Declaration on Cultural Diversity IT cultura E The set of distinctive spiritual, material, intellectual and emotional features of a society or a social group encompassing, in addition to art and literature, lifestyles, ways of living together, value systems, traditions and beliefs. FI kulttuuri GA cultúr D Definition(s) H I J 14. Factors and Impacts of Migration K Euro Voc Classification 2831 culture and religion L MT Kultura M NL cultuur PL kultura N PT cultura RO cultura O SK kultúra SL kultura P SV kultur NO kultur Q KA კულტურა R UK культура HY մշակույթ S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 137
de facto population BG фактическо население CS de facto obyvatelstvo DE De-facto-Bevölkerung / tatsächlich anwesende Bevölkerung EL πραγματικός πληθυσμός (de facto) EN de facto population ES población (de hecho) ET de facto rahvastik (tegelik rahvastik) FI de facto -väestö FR population de fait Definition(s) A concept under which individuals (or vital events) are recorded (or are attributed) to the geographical area where they were present (or occurred) at a specified time. Source(s) OECD Glossary of Statistical Terms Related term(s) de jure population EMN Asylum and Migration Classification HR de facto stanovništvo 6.3.7 Statistics in migration procedures| 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) HU tényleges népesség Euro Voc Classification GA daonra de facto IT popolazione de facto 2816 demography and population LT de facto gyventojų skaičius LV de facto iedzīvotāji MT Popolazzjoni de facto Note(s) This term is little used. NL de facto bevolking PL populacja de facto PT população (de facto) RO populaţie (de facto) / populație în fapt SK obyvateľstvo de facto / faktické obyvateľstvo / prítomné obyvateľstvo SL de facto prebivalstvo / dejansko prebivalstvo SV de facto-befolkning NO tilstedeværende befolkning / de facto befolkning (b); folkesetnad tilstades /de facto-folkesetnad (n) KA დე ფაქტო მოსახლეობა UK фактичне населення HY 138 փաստացի բնակչություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B de facto refugee BG no translation CS uprchlík de facto DE De-facto-Flüchtling EL de facto πρόσφυγας EN de facto refugee ES refugiado de facto ET de facto pagulane FI tosiasiallinen pakolainen FR réfugié de facto GA dídeanaí de facto HR de facto izbjeglica HU de facto menekült IT rifugiato de facto LT de facto pabėgėlis LV de facto bēglis MT Rifuġjat(a) de facto NL de facto vluchteling PL uchodźca de facto PT refugiado de facto RO refugiat de facto C D Definition(s) Person not recognised as a refugee (within the meaning of Art. 1A of the Geneva Refugee Convention and Protocol) and who is unable or, for reasons recognised as valid, unwilling to return to their country of origin or country of nationality or, if they have no nationality, to the country of their habitual residence. E Source(s) H Broader term(s) I Related term(s) J Developed by EMN refugee civil war refugee displaced person humanitarian protection person eligible for subsidiary protection refugee in orbit SV de facto-flykting NO de facto-flyktning KA დე ფაქტო ლტოლვილი UK біженець де факто HY G K L M EMN Asylum and Migration Classification 4. International Protection and other Types of Protection Euro Voc Classification N 2811 migration O Note(s) P SK utečenec de facto SL de facto begunec F 1. This term is not defined in legal terms in the EU Member States. 2. In DE, this refers to a person who has not applied for asylum or whose asylum application has been rejected, but whose removal has been suspended due to concrete danger of life, body or freedom. For example, a person›s stay will be tolerated in DE on grounds of humanitarian law. Q R փաստացի փախստական S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 139
de jure population BG юридическо население CS de jure obyvatelstvo DE De-jure-Bevölkerung EL νόμιμος πληθυσμός (de jure) EN de jure population ES población (de derecho) ET de jure rahvastik FI de jure -väestö FR population de droit GA daonra de jure HR de jure stanovništvo HU hivatalos népességszám IT popolazione de jure LT de jure gyventojų skaičius LV de jure iedzīvotāji Definition(s) A concept under which individuals (or vital events) are recorded (or are attributed) to a geographical area on the basis of the place of residence. Source(s) OECD Glossary of Statistical Terms Related term(s) de facto population EMN Asylum and Migration Classification 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) Euro Voc Classification 2816 demography and population Note(s) This term is little used. MT Popolazzjoni de jure NL de jure bevolking PL populacja de jure PT população (de direito) RO populaţie de drept SK obyvateľstvo de jure / bývajúce obyvateľstvo SL de jure prebivalstvo SV bosatt befolkning / de jure-befolkning NO hjemmehørende befolkning / de jure befolkning (b); folkesetnad etter bustad / de jure-folkesetnad (n) KA დე იურე მოსახლეობა UK юридичне населення HY 140 օրինական բնակչություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A degrading treatment or punishment BG Унизително отношение или наказание CS ponižující zacházení nebo trestání Treatment that humiliates or debases an individual, showing a lack of respect for, or diminishing, their human dignity, or when it arouses feelings of fear, anguish or inferiority capable of breaking an individual’s moral and physical resistance. EL ταπεινωτική μεταχείριση ή τιμωρία EN degrading treatment or punishment ES Pena o trato degradante Source(s) ET alandav kohtlemine või karistamine HU megalázó bánásmód vagy büntetés ECtHR Svinarenko and Slyadnev v. Russia, Applications nos. 32541/08 and 43441/08 based on M.S.S. v. Belgium and Greece, Application no. 30696/09, § 220, ECHR 2011 and El-Masri v. the former Yugoslav Republic of Macedonia, Application No. 39630/09, § 202, ECHR 2012 IT Trattamento o pena degradante FI alentava kohtelu tai rangaistus FR peine ou traitement dégradant GA íde nó píonós táireach HR ponižavajuće postupanje ili kažnjavanje C D Definition(s) DE erniedrigende Behandlung oder Bestrafung B E F G H I J Broader term(s) LT žeminantis orumą elgesys arba baudimas serious harm K LV pazemojoša rīcība vai sodīšana Related term(s) L MT Trattament jew kastig /piena degradanti NL vernederende behandeling of bestraffing / onterende behandeling of bestraffing inhuman treatment or punishment torture M EMN Asylum and Migration Classification 1. Framework Concepts on Migration (including root causes of migration N PT tratamento ou pena degradantes RO tratament degradant sau pedeapsă Euro Voc Classification O PL poniżające traktowanie lub karanie 1236 rights and freedoms SK ponižujúce zaobchádzanie alebo trestanie SL ponižujoče ravnanje ali kaznovanje SV förnedrande behandling eller bestraffning NO nedverdigende behandling eller straff (b); nedverdigande handsaming eller straff (n) KA დამამცირებელი/ღირსების შემლახველი მოპყრობა ან სასჯელი UK поводження чи покарання, що принижує гідність HY նվաստացուցիչ վերաբերմունք կամ պատիժ P Note(s) 1. Prohibition of torture and cruel, inhuman or degrading treatment or punishment is recognised as a right of paramount significance under international human rights law and set out in all major international instruments dealing with civil and political rights, such as in Art. 3 of the European Convention on Human Rights (ECHR). The prohibition, contained in Art. 3 of the ECHR is the only Convention prohibition that is not subject to any limitations or derogations. 2. While the UN Convention against Torture and other Cruel, Inhuman or Degrading Treatment or Punishment (UNCAT) provides a definition of torture, there is no universally accepted definition of inhuman and degrading treatment or punishment. The case law of the European Court of Human Rights (ECtHR) provides at least a source of guidance even though the decision practice of the Court has changed over the time. On the basis of the degree of severity of ill-treatment the Court distinguished and defined three concepts prohibited by Art. 3: (i) torture, (ii) inhuman treatment or punishment and (iii) degrading treatment or punishment. Further, the Court emphasized in the Selmouni vs. France judgement of 28 July 1999 that the hierarchy distinguishing the three categories of ill-treatment is fluid in nature and has to be assessed in harmony with societal pogress. 3. The definition used is taken from the most recent reference to the term in ECtHR case law. The first definitions of the term were established in case law from the 1960s - e.g. Denmark, France, Norway, Sweden and the Netherlands v. Greece, 1969. For more information, see Association for the Prevention of Torture: Guide to Jurisprudence on Torture and Ill-treatment, 2002. 4. The suffering and humiliation involved must in any event go beyond the inevitable element of suffering or humiliation resulting from legitimate treatment or punishment (ECtR Soering v. United Kingdom no. 1/1989/161/217, § 100) EMN ASYLUM AND MIGRATION GLOSSARY 10.0 141 Q R S T U V W X Y Z
dependant BG лице на издръжка CS závislá osoba DE zuzugsberechtigter Familienangehöriger / Familienangehöriger, dem Unterhalt gewährt wird EL συντηρούμενο / εξαρτώμενο μέλος EN dependant ES dependiente ET ülalpeetav FI huollettava FR personne à charge GA cleithiúnaí HR ovisna/uzdržavana osoba HU eltartott IT persona a carico Definition(s) A person who has filed an application for family reunification and who is granted entry and residence by the EU Member State to stay with a legally resident family member or other. Source(s) EMN: Family Reunification of Third-Country Nationals in the EU plus Norway: National Practices, 2016. Related term(s) family member sponsor EMN Asylum and Migration Classification 3.2 Migration for Family Reasons Euro Voc Classification 2806 family| 2811 migration LT išlaikomas asmuo LV apgādājamais MT Persuna dipendenti Note(s) For more information, see EMN: Family reunification, 2016. NL afhankelijk gezinslid /persoon ten laste (very narrow) PL osoba pozostająca na utrzymaniu PT dependente / pessoa a cargo RO persoană aflată în întreținere SK závislá osoba SL vzdrževana oseba / vzdrževani družinski član SV anhörig NO forsørget person (b); forsørgd person (n) KA (ოჯახის წევრზე) დამოკიდებული / კმაყოფაზე მყოფი პირი UK утриманець HY 142 խնամքի տակ գտնվող անձ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B detainee C BG задържан D Definition(s) CS zajištěný cizinec E A person in detention. DE Häftling Source(s) EL κρατούμενος F Developed by EMN EN detainee Related term(s) ES detenido ET kinnipeetav FI säilöön otettu FR personne retenue (FR, LU); personne détenue (BE); personne placée en détention (BE); personne placée en rétention (FR, LU) detention G EMN Asylum and Migration Classification Euro Voc Classification H 12 Law| 1236 rights and freedoms I GA duine atá á choinneáil J HR osoba kojoj je ograničena sloboda kretanja/osoba u detenciji K HU őrizetes L IT persona trattenuta LT sulaikytasis M LV aizturētais MT Detenut(a) N NL gedetineerde (NL, BE); in vreemdelingenbewaring gestelde persoon (NL); vastgehouden / opgesloten persoon (BE) (in case of return) O PL osoba zatrzymana P PT detido RO deținut Q SK zaistená osoba SL pridržana oseba R SV förvarstagen person NO innsatt (b); innsett (n) S KA დაკავებული პირი T UK затримана особа HY ձերբակալված U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 143
detection of a victim of trafficking in human beings BG откриване на жертва на трафик на хора CS identifikace oběti obchodování s lidmi DE Erkennung eines Opfers von Menschenhandel EL εντοπισμός θύματος εμπορίας ανθρώπων (EL); εντοπισμός θύματος εμπορίας προσώπων (CY) EN detection of a victim of trafficking in human beings ES detección de víctimas de trata de seres humanos ET inimkaubanduse ohvri staatuse tuvastamine FI ihmiskaupan uhrin havaitseminen FR détection d’une victime de la traite des êtres humains GA íospartach gáinneála a aimsiú HR otkrivanje žrtve trgovanja ljudima HU emberkereskedelem áldozatának felderítése IT individuazione della vittima di tratta degli esseri umani Definition(s) The process of identifying a possible situation of trafficking in human beings. Source(s) Derived by EMN from Varandas, I. & J. Martins: Signalling Identification Integration of Victims of Trafficking for Sexual Exploitation: Construction of a Guide, 2007 Broader term(s) trafficking in human beings Related term(s) identification of a victim of trafficking in human beings EMN Asylum and Migration Classification 13.2 Trafficking in human beings Euro Voc Classification 12 Law LT prekybos žmonėmis aukos atpažinimas LV cilvēku tirdzniecības upura atpazīšana MT Sejbien ta’ vittma fit-traffikar tal-persuni NL detectie van een slachtoffer van mensenhandel PL identyfikacja ofiar handlu ludźmi PT deteção de vítima de tráfico de seres humanos RO detectarea unei victime a traficului de ființe umane / identificarea unei victime a traficului de fiinte umane / depistarea unei victime a traficului de ființe umane SK zisťovanie či je osoba obeťou obchodovania s ľuďmi SL zaznava žrtve trgovine z ljudmi SV upptäckt av offer för människohandel NO identifisering av et offer for menneskehandel (b); identifisering av eit offer for menneskehandel (n) KA ადამიანით ვაჭრობის (ტრეფიკინგის) მსხვერპლის გამოვლენა UK виявлення жертви торгівлі людьми HY 144 մարդկանց թրաֆիքինգի զոհի հայտնաբերում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 145
detention BG задържане CS zajištění DE Abschiebungshaft; Schubhaft (AT) EL κράτηση (διοικητική) EN detention ES internamiento ET kinnipidamine FI säilöönotto FR rétention (EU acquis, FR, LU); détention (BE) GA coinneáil HR detencija/ograničenje slobode kretanja HU fogvatartás / őrizet IT trattenimento LT sulaikymas LV aizturēšana MT Detenzjoni NL detentie; vreemdelingenbewaring (NL) (in context of return) PL detencja / zatrzymanie PT detenção RO custodie publică SK zaistenie SL pridržanje SV förvar NO forvaring Definition(s) In the global migration context, non-punitive administrative measure ordered by an administrative or judicial authority(ies) in order to restrict the liberty of a person through confinement so that another procedure may be implemented. In the EU asylum context, confinement (i.e. deprivation of liberty) of an applicant for international protection by an EU Member State within a particular place, where the applicant is deprived of their personal liberty. Source(s) Global context: Derived by EMN from the definition of ‘detention’ in UNESCO’s People on the Move Handbook EU context: Art. 2(h) of Directive 2013/33/EU (Recast Reception Conditions Directive) and Art. 26 of Directive 2013/32/EU (Recast Asylum Procedures Directive) Narrower term(s) detention facility detention standards and conditions Related term(s) alternative to detention detainee EMN Asylum and Migration Classification 11. Detention and Alternatives to Detention Euro Voc Classification 12 Law| 1236 rights and freedoms KA დაკავება UK тримання під вартою HY 146 կալանավորում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. EU provisions differentiate between different migration situations in which third-country nationals can be detained: detention of applicants for international protection, detention in order to prevent irregular entry into the territory of EU Member States and detention of irregular migrants involved in return proceedings. 2. Applicants for international protection may be detained at any stage of or throughout the asylum process, from the time an initial application is made up to the point of removal of an unsuccessful applicant for international protection. According to Art. 26 of Directive 2013/32/EU (Recast Asylum Procedure Directive) it is not acceptable to detain a person solely for the reason that they have lodged an application for international protection. To ensure the non-arbitrariness of detention and the respect of fundamental rights of applicants for international protection, Directive 2013/33/EU (Recast Reception Conditions Directive) introduced an exhaustive list of detention grounds (Art. 8) and put in place a number of procedural guarantees.The Directive also regulates the conditions in detention facilities (Art. 10). 3. Although Directive 2008/115/EC (Return Directive) does not give a definition for detention, it sets grounds for detention and states that detention for the purpose of removal should be limited and subject to the principle of proportionality and that third-country nationals in detention should be treated in a humane and dignified manner with respect for their fundamental rights and in compliance with international and national law. Pursuant to Art. 15(1) of the Return Directive, EU Member States may only detain or keep in a detention facility a third-country national who is the subject of return procedures in order to prepare the return and / or carry out the removal process, in particular when: (a) there is a risk of absconding; or (b) the third-country national concerned avoids or hampers the preparation of return or the removal process. Any detention shall be for as short a period as possible and only maintained as long as removal arrangements are in progress and executed with due diligence, see Art.15 (1). 4. For further information, see EMN: The use of detention and alternatives to detention in the context of immigration policies, 2014 and EMN: Detention and Alternatives to detention in international protection and return procedures, 2021. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 147
detention facility BG място за задържане CS zařízení pro zajištění cizinců Definition(s) FR centre de rétention (EU acquis; FR, LU); centre fermé (BE) In the global context, a specialised facility used for the detention of third-country nationals in accordance with national law. In the EU return context, a specialised facility to keep in detention a third-country national who is the subject of return procedures in order to prepare the return and/ or carry out the removal process, in particular when: (a) there is a risk of absconding; or (b) the third-country national concerned avoids or hampers the preparation of return or the removal process. GA ionad coinneála Source(s) DE Hafteinrichtung (EU acquis, AT, DE); Abschiebehaftanstalt (LU) EL χώρος κράτησης (κρατητήρια) EN detention facility ES centro de internamiento ET kinnipidamisasutus FI säilöönottoyksikkö IT struttura di trattenimento Global context: Derived by EMN from Art. 16 of Directive 2008/115/EC (Return Directive) EU return context: Art. 15(1) of Directive 2008/115/EC (Return Directive) LT sulaikymo centras Synonym(s) HR objekt za ograničenje slobode kretanja HU őrzött szállás / fogda LV aizturēšanas telpa MT Ċentru / Faċilità ta’ detenzjoni NL detentievoorziening; inrichting voor vreemdelingenbewaring (NL) / gesloten centrum (BE) PL ośrodek detencyjny PT centro de instalação temporária RO centru de cazare a străinilor luaţi în custodie publică SK útvar policajného zaistenia pre cudzincov (ÚPZC) / zariadenie určené pre zaistenie cudzincov (EU acquis) SL center za pridržanje detention centre Broader term(s) detention Euro Voc Classification 12 Law| 1236 rights and freedoms Note(s) Where an EU Member State cannot provide accommodation in a specialised detention facility and is obliged to resort to prison accommodation, the third-country nationals in detention shall be kept separated from ordinary prisoners. SV förvarsanläggning NO forvaringsleir KA დაკავების დაწესებულება UK установа тримання під вартою HY 148 կալանավայր EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 149
detention standards and conditions BG Стандарти и условия за задържане CS standardy a podmínky zajištění DE Haftstandards und -bedingungen EL Πρότυπα και συνθήκες κράτησης EN detention standards and conditions ES Condiciones y garantías de internamiento ET kinnipidamisnõuded ja -tingimused FI säilöönotto-olosuhteet FR normes et conditions de rétention (EU acquis, FR, LU); normes et conditions de détention (BE) GA caighdeáin agus dálaí coinneála Definition(s) In the context of migration, all basic principles relating to the fundamental rights and treatment of migrants held in administrative detention including the right to legal remedies, the rules of detention procedures, communication with legal advisers, counsellors and persons representing international and non-governmental organisations, material conditions of accommodation, personal development, access to healthcare and measures to ensure order, safety and the protection of migrants in detention. Source(s) MT Normi u kondizzjonijiet tad-detenzjoni Derived by EMN from Council of Europe, European Committee on Legal Cooperation (CDCJ): Codifying instrument of European rules on the administrative detention of migrants, May 2017 and Art. 9, 10 and 11 of Directive 2013/33/EU (Recast Reception Conditions Directive) and Art. 15, 16 and 17 of Directive 2008/115/EC (Return Directive) NL Detentienormen en -voorwaarden / omstandigheden Synonym(s) HR standardi i uvjeti za ograničenje slobode kretanja HU fogvatartási normák és körülmények IT standard e condizioni del trattenimento LT sulaikymo standartai ir sąlygos LV aizturēšanas standarti un apstākļi PL warunki i normy/standardy zatrzymania PT normas e condições de detenção RO standarde și condiții de luare în custodie publică / standarde și condiții de detenție SK normy a podmienky zaistenia SL standardi in pogoji pridržanja SV normer och villkor för förvar NO Vilkår for og standard ved ved forvaring KA დაკავების სტანდარტები და პირობები UK стандарти та умови тримання під вартою HY 150 կալանավորման չափորոշիչներ և պայմաններ conditions of detention detention conditions detention guarantees detention standards guarantees for detention Broader term(s) detention Related term(s) detainee detention facility Euro Voc Classification 12 Law| 1236 rights and freedoms EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. Basic principles related to the treatment of migrants in detention were laid down e.g. by the Council of Europe’s European Committee on Legal Cooperation (CDCJ) in its Codifying instrument of European rules on the administrative detention of migrants, May 2017 or in the UNHCR Guidelines on the Applicable Criteria and Standards relating to the Detention of Asylum-Seekers and Alternatives to Detention, 2012. 2. In the EU context, Directive 2013/33/EU (Recast Reception Conditions Directive) and Directive 2008/115/EC (Return Directive) include standards (guarantees) and rules (conditions) on the detention of applicants for international protection, ensuring that their fundamental rights are respected. 3. Guarantees for detained applicants for international protection are laid down in Art. 9 of Directive 2013/33/EU resp. Art. 15 of Directive 2008/115/EC, e.g. detention for the shortest period possible and only as long as the grounds for detention are applicable, detention must be ordered in writing by judicial or administrative authorities and access to free legal assistance and representation. 4. Art.10 of Directive 2013/33/EU resp. Art. 16 of Directive 2008/115/EC refer to conditions of detention. Detention of migrants shall take place as a rule in specialised detention facilities. Where an EU Member State cannot provide accommodation in a specialised detention facility and is obliged to resort to prison accommodation, migrants shall be kept separated from ordinary prisoners. EU Member States shall ensure that family members, legal advisers or counselors and persons representing relevant international and non-governmental organisations such the United Nations High Commissioner for Refugees (UNHCR) have the possibility to communicate with and visit applicants. Applicants in detention shall be systematically provided with information which explains the rules applied in the facility and sets out their rights and obligations in a language which they understand. 5. According to Art. 11 of Directive 2013/33/EU resp. Art.17 of Directive 2008/115/EC particular attention shall be paid to the situation of vulnerable persons. Unaccompanied minors and families with minors shall only be detained as a measure of last resort and for the shortest appropriate period of time. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 151
determining authority BG решаващ орган CS rozhodující orgán DE Asylbehörde EL αποφαινόμενη αρχή EN determining authority ES autoridad decisoria de asilo ET tuvastav asutus Definition(s) In the context of international protection, any quasi-judicial or administrative body in an EU Member State responsible for examining applications for international protection that is competent to take decisions at first instance in such cases. Source(s) FI määrittävä turvapaikkaviranomainen Art. 2(f) of Directive 2013/32/EU (Recast Asylum Procedures Directives) FR autorité responsable de la détermination Synonym(s) GA údarás cinntitheach determining asylum authority HR nadležno tijelo Related term(s) HU menedékjog iránti kérelem elbírálásáért felelős hatóság case worker in procedures for international protection IT autorità responsabile per il riconoscimento dello status di rifugiato 6.2.3 First Instance (Administrative) determination procedure LT sprendžiančioji institucija (EU acquis); prašymą nagrinėti ir sprendimą dėl prieglobsčio suteikimo priimti įgaliota institucija EMN Asylum and Migration Classification Euro Voc Classification 12 Law| 2811 migration LV atbildīgā iestāde MT Awtorità għat-teħid ta’ deċiżjonijiet dwar l-ażil NL beslissingsautoriteit inzake internationale bescherming PL organ rozpatrujący wniosek PT autoridade responsável pela decisão (asilo) RO autoritatea responsabilă cu examinarea cererii de azil /autoritate decizională SK rozhodujúci orgán zodpovedný za preskúmanie žiadosti o udelenie azylu SL organ za presojo SV beslutande myndighet NO asylmyndighet (b); asylstyresmakt (n) KA სტატუსის დამდგენი ორგანო UK орган, який приймає рішення HY 152 լրազոր մարմին EMN ASYLUM AND MIGRATION GLOSSARY 10.0
Dialogue on Mediterranean Transit Migration BG Диалог по Средиземно транзитната миграция A B C D Definition(s) CS Dialog o středomořské tranzitní migraci DE Dialog über Transitmigration im Mittelmeerraum EL ∆ιάλογο για τη µετανάστευση µέσω Μεσογείου EN Dialogue on Mediterranean Transit Migration ES Diálogo sobre la Migración de Tránsito en el Mediterráneo ET Vahemere transiitrände dialoog FI Välimeren kauttakulkumuuttoa koskeva vuoropuhelu FR Dialogue sur la migration de transit en Méditerranée GA Idirphlé maidir le hImirce Idirthurais trasna na Meánmhara An inter-regional intergovernmental consultative forum of migration officials in countries of origin, transit and destination along the migration routes in Africa, Europe and the Middle East with a focus on irregular and mixed migration, as well as on migration and development in the Mediterranean region and beyond, aiming to build common understandings and to jointly develop evidence-based comprehensive and sustainable migration management systems. E Source(s) I Description of Mediterranean Transit Migration (MTM) on the website of IOM Synonym(s) HR Dijalog o tranzitnim migracijama u Sredozemlju MTM HU Párbeszéd a Mediterrán Tranzit Migrációról IT Dialogo sulla Migrazione di Transito nel Mediterraneo F G H J K Related term(s) Africa-EU Migration, Mobility and Employment Partnership Five plus Five (5+5) Dialogue on Migration in the Western Mediterranean Global Approach to Migration and Mobility (GAMM) Global Forum on Migration and Development (GFMD) L PL Dialog nt. migracji tranzytowych w regionie basenu Morza Śródziemnego EMN Asylum and Migration Classification 15.1 EU External dimension of migration and mobility O PT Diálogo sobre migração de trânsito no Mediterrâneo Euro Voc Classification P LT Migracijos dialogas Viduržemio jūros regiono tranzitui LV Vidusjūras tranzīta migrācijas dialogs MT Djalogu fuq il-Migrazzjoni tat-Transitu fil‑Mediterran NL dialoog rond transmigratie in het Middellandse Zeegebied RO Dialogul cu privire la migraţia de tranzit în zona Mediteranei Q Note(s) SL Dialog o tranzitnih migracijah v Sredozemlju SV dialog om transitmigration i Medelhavsområdet NO Dialogen om transittmigrasjon i Middelhavet KA დიალოგი ხმელთაშუაზღვისპირეთში სატრანზიტო მიგრაციის თაობაზე UK Діалог про транзитну міграцію в Середземномор’ї Երկխոսություն միջերկրածովյան տարանցիկ միգրացիայի վերաբերյալ N 2811 migration SK Dialóg o tranzitnej migrácii v Stredomorí HY M 1. The MTM Dialogue started in 2002 and involves numerous partcipants from Arab (APS) and European partner states (EPS) as well as seven international organisations.The International Centre for Migration Policy Development (ICMPD) serves as its secretariat. Initially focusing on transit migration, the MTM extended its scope over the years to cover various aspects of migration management in the Mediterranean region and beyond. 2. The Dialogue on Mediterranean Transit Migration is built on two pillars. The first one focuses on enhancing operational cooperation to combat irregular migration or, in other terms, on shorter-term measures to address irregular flows. The second pillar deals with a longer-term perspective by focusing on addressing the root causes of irregular flows through development cooperation and a better joint management of migration. These pillars are used as frameworks for the implementation of specific projects but cross-pillar projects are also put in place. R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 153
diaspora BG диаспора CS diaspora DE Diaspora EL Διασπορά EN diaspora ES diáspora ET diasporaa FI diaspora FR diaspora GA diaspóra HR dijaspora HU diaszpóra IT diaspora LT diaspora LV diaspora MT Dijaspora NL diaspora PL Diaspora Definition(s) Individuals and members of networks, associations and communities, who have left their country of origin, but maintain links with their homelands. Source(s) Derived by EMN from IOM Glossary on Migration, 2019. Related term(s) circular migration EMN Asylum and Migration Classification 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) Euro Voc Classification 2811 migration Note(s) 1. This concept covers more settled expatriate communities, migrant workers based abroad temporarily, expatriates with the nationality of the host country, dual nationals and second-/third-generation migrants. 2. It is a general term, with no legal definition, which can also cover EU Member State nationals (and immigrants) who feel strong connections to their origins. PT diáspora RO diaspora SK diaspóra SL diaspora SV diaspora NO diaspora KA დიასპორა UK діаспора HY 154 սփյուռք EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B direct discrimination BG пряка дискриминация CS přímá diskriminace DE unmittelbare Diskriminierung EL άμεση διάκριση EN direct discrimination ES discriminación directa A situation in which one person is treated less favourably than another is, has been or would be treated in a comparable situation on grounds of racial or ethnic origin. E Source(s) G ET otsene diskrimineerimine FI välitön syrjintä Broader term(s) FR discrimination directe HR izravna diskriminacija D Definition(s) Art. 2(2a) of Council Directive 2000/43/EC (Racial Equality Directive) GA idirdhealú díreach C F H principle of equal treatment I EMN Asylum and Migration Classification HU közvetlen diszkrimináció 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) J IT discriminazione diretta Euro Voc Classification K LT tiesioginė diskriminacija 1236 rights and freedoms L LV tieša diskriminācija MT Diskriminazzjoni diretta M NL directe discriminatie PL dyskryminacja bezpośrednia N PT discriminação direta RO discriminare directă O SK priama diskriminácia SL neposredna diskriminacija P SV direkt diskriminering NO direkte diskriminering Q KA პირდაპირი დისკრიმინაცია R UK пряма дискримінація HY ուղղակի խտրականություն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 155
displaced person BG разселено лице CS vysídlená osoba DE Vertriebener EL εκτοπισθείς EN displaced person ES población desplazada ET ümberasustatud isik FI siirtymään joutunut henkilö FR personne déplacée GA duine easáitithe HR raseljena osoba HU lakóhelyét elhagyni kényszerült személy IT sfollato LT perkeltasis asmuo LV pārvietota persona MT Persuna spostata / li kellha tħalli darha NL ontheemde PL osoba przesiedlona PT deslocado RO persoană strămutată Definition(s) In the global context, persons or groups of persons who have been forced or obliged to flee or to leave their homes or places of habitual residence, either across an international border or within a State, in particular as a result of or in order to avoid the effects of armed conflict, situations of generalized violence, violations of human rights or natural or human-made disasters. In the EU context, a third-country national or stateless person who has had to leave their country or region of origin, or has been evacuated, particularly in response to an appeal by international organisations, and is unable to return in safe and durable conditions because of the situation prevailing in that country, who may fall within the scope of Art. 1A of the Geneva Refugee Convention and Protocol or other international or national instruments giving international protection, in particular: (i) persons who have fled areas of armed conflict or endemic violence; (ii) persons at serious risk of, or who have been the victims of, systematic or generalised violations of their human rights. Source(s) SL razseljena oseba Global context: IOM Glossary on Migration, 2019 EU-context: Art. 2(c) of Council Directive 2001/55/EC (Temporary Protection Directive) SV fördriven person Broader term(s) SK vysídlená osoba / vysídlenec (EU acquis); odídenec NO fordrevet person (b); fordriven person (n) KA გადაადგილებული პირი UK переміщена особа HY տեղահանված անձ forced migrant Narrower term(s) environmentally displaced person internally displaced person Related term(s) civil war refugee de facto refugee displacement refugee EMN Asylum and Migration Classification 1. Framework Concepts on Migration (including root causes of migration| 4. International Protection and other Types of Protection Euro Voc Classification 2811 migration 156 EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B displacement BG Разселване CS vysídlení DE Vertreibung EL εκτόπιση/ εκτοπισμός EN displacement ES Desplazamiento ET sundränne FI siirtymään joutuminen FR déplacement GA easáitiú HR raseljavanje HU lakhelyelhagyás / lakóhely elhagyása IT Sfollamento LT perkėlimas LV pārvietošana MT Spostament NL verplaatsing / ontheemding / verdrijving PL przesiedlenie PT deslocação C D Definition(s) In the global context, the movement of persons who have been forced or obliged to flee or to leave their homes or places of habitual residence, in particular as a result of or in order to avoid the effects of armed conflict, situations of generalized violence, violations of human rights or natural or human-made disasters. In the EU context, the movement of third-country nationals or stateless persons who have had to leave their country or region of origin, or have been evacuated, in particular in response to an appeal by international organisations, and are unable to return in safe and durable conditions because of the situation prevailing in that country, who may fall within the scope of Article 1A of the Geneva Refugee Convention and Protocol or other international or national instruments giving international protection, in particular: (i) persons who have fled areas of armed conflict or endemic violence; (ii) persons at serious risk of, or who have been the victims of, systematic or generalised violations of their human rights. E Source(s) N SL razselitev Global context: Derived by EMN from IOM Glossary on Migration, 2019 EU-context: Derived by EMN from Art. 2(c) of Council Directive 2001/55/EC (Temporary Protection Directive) SV fördrivning Broader term(s) RO strămutarea forțată a populației / strămutarea SK vysídlenie NO fordrivelse (b); fordriving (n) KA (იძულებითი) გადაადგილება UK переміщення HY տեղահանում forced migration F G H I J K L M O P Q Narrower term(s) R environmentally displaced person Related term(s) S temporary protection EMN Asylum and Migration Classification T 1. Framework Concepts on Migration (including root causes of migration| 4. International Protection and other Types of Protection U Euro Voc Classification V 2811 migration W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 157
distribution key BG Разпределителен ключ CS distribuční klíč Definition(s) ES Clave de distribución The method used to determine the acceptance quota and to allocate applicants for international protection to different regions of a country or different EU Member States on the basis of criteria such as relative size of the region / EU Member State, population density, wealth and absorption capacities. ET jaotuskvoot Source(s) DE Verteilungsschlüssel EL κλείδα κατανομής EN distribution key HR ključ raspodjele Derived by EMN from the description of ‘distribution key’ in European Commission: Communication Towards a reform of the Common European Asylum System and enhancing legal avenues to Europe, COM (2016) 197 final. HU elosztási kulcs Synonym(s) FI EU:n taakanjaon määrittämisperusteet FR clé de répartition GA eochair dáileacháin IT Chiave di distribuzione distribution of applicants for international protection LT paskirstymo raktas EMN Asylum and Migration Classification LV sadales koeficients MT Gwida għat-tqassim tal-applikanti NL verdeelsleutel PL kryteria rozproszenia 4.4 Reception and Accommodation of Applicants for international protection and other refugees Euro Voc Classification 2811 migration PT chave de distribuição/repartição RO cheie de repartizare SK distribučný kľúč SL razdelitveni ključ SV fördelningsnyckel NO fordelingsnøkkel KA განაწილების კოეფიციენტი UK ключ розподілу HY 158 բաշխման բանալի (մեթոդ) EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B dual citizenship C BG двойно гражданство D Definition(s) CS dvojí občanství DE doppelte Staatsangehörigkeit / doppelte Staatsbürgerschaft / Doppelstaatigkeit EL διπλή ιθαγένεια The simultaneous possession of two or more citizenships by the same person. E Source(s) F EN dual citizenship Derived by EMN from Art. 2b of the European Convention on Nationality ES doble nacionalidad Synonym(s) G multiple citizenship multiple nationality H FI monikansalaisuus FR double nationalité Broader term(s) I Euro Voc Classification J ET topeltkodakondsus citizenship GA déshaoránacht HR dvojno državljanstvo 1011 European Union law| 12 Law HU kettős állampolgárság K IT doppia cittadinanza LT kelių valstybių pilietybė L LV dubultā pilsonība MT Ċittadinanza doppja M NL meervoudige nationaliteit / meervoudig staatsburgerschap N PL podwójne obywatelstwo O PT dupla nacionalidade RO cetățenie dublă P SK dvojité štátne občianstvo / dvojitá štátna príslušnosť (dual citizenship) / viacnásobné štátne občianstvo / viacnásobná štátna príslušnosť (multiple citizenship) Q SL dvojno državljanstvo R SV dubbelt medborgarskap NO dobbelt statsborgerskap (b); dobbel statsborgarskap (n) S KA ორმაგი მოქალაქეობა T UK подвійне громадянство HY երկքաղաքացիություն U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 159
Dublin Convention BG Дъблинска конвенция CS Dublinská úmluva DE Dubliner Übereinkommen EL Σύμβαση του Δουβλίνου EN Dublin Convention ES Convenio de Dublín ET Dublini konventsioon FI Dublinin yleissopimus FR Convention de Dublin GA Coinbhinsiún Bhaile Átha Cliath HR Dublinska konvencija HU Dublini Egyezmény IT Convenzione di Dublino Definition(s) Convention determining the EU Member State responsible for examining an application for asylum lodged in one of the EU Member States. Source(s) Dublin Convention Related term(s) Dublin procedure Dublin Regulation Dublin transfer Eurodac transfer order Euro Voc Classification 1011 European Union law| 2811 migration LT Dublino konvencija LV Dublinas konvencija MT Konvenzjoni (Il-) ta’ Dublin NL Overeenkomst van Dublin PL Konwencja Dublińska PT Convenção de Dublin Note(s) 1. The Dublin Convention was signed in Dublin, Ireland on 15 June 1990, and first came into force on 1 September 1997 for the first 12 signatories. The Treaty has been extended to other EU Member States and some countries outside the European Union. 2. The Dublin Convention was replaced by Council Regulation No 343/2003 (Dublin II regulation). Its validity ended on 16 March 2003. RO Convenția de la Dublin SK Dublinský dohovor SL Dublinska konvencija SV Dublinkonventionen NO Dublin-konvensjonen KA დუბლინის კონვენცია UK Дублінська конвенція HY 160 Դուբլինի Համաձայնություն (Կոնվեցիա) EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B Dublin criteria BG критерии по Регламента „Дъблин“ CS Dublinská kritéria DE Dublin-Kriterien / Dublin-Zuständigkeitskritierien EL Κριτήρια του Κανονισμού Δουβλίνου EN Dublin criteria ES criterios del Reglamento de Dublín / criterios de responsabilidad ET Dublini kriteeriumid FI Dublin-perusteet C D Definition(s) Objective criteria applied hierarchically in order to determine the (EU) Member State responsible for the examination of an application for international protection on the basis of the situation obtaining when a third-country national or stateless person first lodged the application within an (EU) Member State, as laid down in chapter III of Regulation(EU) No 604/2013 (Dublin III Regulation). Source(s) E F G H I HR dublinski kriterij Derived by EMN from Chapter III of Regulation (EU) No 604/2013 (Dublin III Regulation) and the entry of ‘Dublin criteria’ in the IATE terminology database HU dublini kritériumok / felelősségi feltételek Synonym(s) K FR critères de Dublin GA critéir Bhaile Átha Cliath IT Criteri di determinazione dello Stato competente ai sensi del Regolamento Dublino LT Dublino reglamento kriterijai Dublin responsibility criteria responsibility criteria in the context of the Dublin Regulation LV Dublinas kritēriji J L Broader term(s) MT riterji ta’ Dublin / kriterji ta’ responsabbiltà Dublin Regulation M NL Dublin criteria Related term(s) N PL kryteria dublińskie / kryteria ustalania odpowiedzialności Dublin procedure Dublin transfer PT critérios de Dublin EMN Asylum and Migration Classification RO criterii Dublin / criterii de responsabilitate SK dublinské kritériá SL dublinska merila SV Dublinkriterier NO Dublin-kriterier KA დუბლინის კონვენციით განსაზღვრული კრიტერიუმები UK Дублінські критерії HY Դուբլինի կանոնակարգման չափանիշներ O 6.2.2 Dublin Procedure P Euro Voc Classification 1011 European Union law| 2811 migration Q Note(s) R 1. The criteria for establishing responsibility are, in hierarchical order: ƒ family considerations (protection of unaccompanied minors and family unity); ƒ recent possession of visa or residence permits in an EU Member State and ƒ whether the applicant coming from a third country has entered EU irregularly, or regularly. Pursuant to Art. 7 of Regulation (EU) No 604/2013 (Dublin III Regulation) the criteria must be applied in order in which they are set out in chapter 3. This means that a higher article number (e.g. Article 9) cannot be applied if a lower article number is already applicable (e.g. Article 8). 2. The evaluation of the Dublin III Regulation showed however, that despite family unity criteria being at the top of the hierarchy, the criteria most often used in practice are those related to documentation and first country of entry (Art. 12 and 13 of Dublin III Regulation). For more information see: DG Migration and Home Affairs:Evaluation of the Dublin III Regulation, final report, 18 March 2016. S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 161
Dublin procedure BG Дъблинска процедура / процедура за определяне на държавата членка, компетентна за разглеждането на молба за международна закрила Definition(s) EL διαδικασία του Δουβλίνου The process of determining the EU Member State responsible for examining an application for international protection lodged in one of the EU Member States by a third-country national under Regulation (EU) No 604/2013 (Dublin III Regulation) . EN Dublin procedure Source(s) CS dublinské řízení DE Dublin-Verfahren ES Procedimiento de Dublin ET Dublini menetlus FI Dublin-menettely Derived by EMN from Art. 20 of Regulation (EU) No 604/2013 (Dublin III Regulation) Related term(s) HU dublini eljárás Dublin Convention Dublin Regulation Dublin transfer Eurodac transfer order IT procedura Dublino EMN Asylum and Migration Classification FR procédure de Dublin GA nós imeachta Bhaile Átha Cliath HR dublinski postupak LT procedūra pagal Dublino reglamentą LV Dublinas procedūra MT Proċedura (Il-) ta’ Dublin 6.2.2 Dublin Procedure Euro Voc Classification 1011 European Union law| 2811 migration NL Dublinprocedure PL procedura dublińska PT procedimento de Dublin RO sistemul Dublin / procedura Dublin SK dublinské konanie SL dublinski postopek SV Dublinprocess NO Dublin-prosedyren KA დუბლინის პროცედურა UK Дублінська процедура HY 162 Դուբլինի Գործընթաց EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B Dublin Regulation BG Регламент „Дъблин“ CS Dublinské nařízení DE Dublin-Verordnung EL Κανονισμός του Δουβλίνου EN Dublin Regulation ES Reglamento de Dublín ET Dublini määrus FI Dublin-asetus FR règlement Dublin C D Definition(s) Regulation which lays down the criteria and mechanisms for determining the (EU) Member State responsible for examining an application for international protection lodged in one of the (EU) Member States by a third-country national or a stateless person. Source(s) Regulation (EU) No 604/2013 (Dublin III Regulation) E F G H Narrower term(s) I HU dublini rendelet Dublin criteria Dublin procedure Dublin transfer transfer order IT Regolamento Dublino Related term(s) K GA Rialachán Bhaile Átha Cliath HR Dublinska uredba LT Dublino reglamentas LV Dublinas regula MT Regolament (Ir-) ta’ Dublin NL Dublinverordening PL Rozporządzenie Dublińskie PT Regulamento de Dublin RO Regulamentul Dublin SK dublinské nariadenie SL Dublinska uredba SV Dublinförordningen NO Dublin-forordningen (b); Dublin-forordninga (n) KA დუბლინის რეგულაცია J asylum shopping Dublin Convention Eurodac L EMN Asylum and Migration Classification M Euro Voc Classification N 6.2.2 Dublin Procedure 1011 European Union law| 2811 migration O Note(s) 1. The Dublin Regulation entered into force on 1 January 2014 and is binding on all EU Member States, as well as on the four Schengen Associated States CH, IC, LI and NO. 2. For more information on the Dublin Regulation, see the description on the DG HOME and Migration website Q R UK Дублінський регламент HY P Դուբլինի Կանոնակարգ S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 163
Dublin transfer BG прехвърляне по Регламента „Дъблин“ CS transfer podle dublinského nařízení DE Übertragung der Zuständigkeit; Dublin-Überstellung / Überstellung nach der Dublin-Verordnung EL μεταφορά στο πλαίσιο του Κανονισμού του Δουβλίνου EN Dublin transfer ES Decisión de traslado según el procedimiento de Dublín ET Dublini üleandmine/Dublini määruse alusel üleandmine Definition(s) 1. The transfer of responsibility for the examination of the merits of an application for international protection from one (EU) Member State to another (EU) Member State. 2. The (physical) transfer of an applicant to the (EU) Member State who is considered to be responsible for examining the merits of an application following a Dublin procedure. Source(s) GA aistriú Bhaile Átha Cliath (a) Derived by EMN from Art. 17(2) and 19(1) of Regulation (EU) No 604/2013 (Dublin III Regulation) (b) Derived by EMN from Art. 29 of Regulation (EU) No 604/2013 (Dublin III Regulation) HR dublinski transfer Broader term(s) FI Dublin-asetuksen mukainen siirto FR transfert Dublin HU dublini transzfer Dublin Regulation IT Trasferimento Dublino Narrower term(s) LT perdavimas pagal Dublino reglamentą LV personas pārsūtīšana saskaņā ar Dublinas regulu MT Trasferiment skont il-proċedura ta’ Dublin NL Dublinoverdracht PL przekazanie w ramach procedury dublińskiej PT transferência ao abrigo do Regulamento de Dublin RO transfer efectuat în temeiul Regulamentului Dublin SK odovzdanie (EU acquis) / dublinský transfer SL prenos odgovornosti / predaja po Dublinski uredbi SV Dublinöverföring NO Dublin-overføring (av ansvar) KA გადაცემა/გადაყვანა დუბლინის რეგულაციის შესაბამისად UK Трансфер за Дублінським регламентом HY 164 Դուբլինի կանոնակարգման համաձայն փոխանցում take back request take charge request transfer order Related term(s) Dublin criteria Dublin procedure EMN Asylum and Migration Classification 6.2.2 Dublin Procedure Euro Voc Classification 1011 European Union law| 2811 migration Note(s) 1. The determination of the (EU) Member State responsible for examining an application for international protection is done on the basis of objective and hierarchical criteria, as laid out in Chapter III of Regulation (EU) No 604/2013 (Dublin III Regulation) . 2. In order to implement a Dublin transfer, a transfer request is issued which is defined as follows: formal procedure in which an (EU) Member State carrying out the process of determining the (EU) Member State responsible submits a request for the transfer of an applicant for international protection to the (EU) Member State designated deemed responsible, after acceptance of a take charge or take back request. 3. For more information on the Dublin Regulation, see the description on the DG Home and Migration website. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B durable solutions BG трайни решения CS trvalá řešení C D Definition(s) Any means by which the situation of forced migrants (displaced persons, refugees, applicants for international protection, internally displaced persons, vulnerable irregular migrants) can be satisfactorily and permanently resolved to enable them to lead an independent life in their country of origin, host country or the country of return. E Source(s) H GA buanréitigh; réitigh mharthanacha (uatha: buanréiteach; réiteach marthanach) Narrower term(s) I HR trajna rješenja Related term(s) J DE dauerhafte Lösungen EL βιώσιμες λύσεις EN durable solutions ES soluciones duraderas ET püsivad lahendused FI kestävät ratkaisut FR solutions durables Derived by EMN from UNHCR Master Glossary of Terms resettlement HU fenntartható megoldások relocation IT soluzioni durevoli EMN Asylum and Migration Classification LT ilgalaikiai sprendimai LV ilgtspējīgi risinājumi MT Soluzzjonijiet dewwiema / li jibqgħu fis-seħħ NL duurzame oplossingen PL trwałe rozwiązania PT soluções duradouras RO solutii durabile SK trvalé riešenia / trvácne riešenia (depending on the context) SL trajne rešitve SV hållbara lösningar NO varige løsninger (b); varige løysingar (n) KA (პრობლემის) გრძელვადიანი გადაწყვეტა UK довгострокові рішення HY կայուն լուծումներ F G K 4. International Protection and other Types of Protection| 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) Euro Voc Classification 2811 migration L M N Note(s) 1.The United Nations High Commissioner for Refugees (UNHCR) traditionally focuses on the protection of refugees and pursues the durable solutions of voluntary repatriation into the country of origin, local integration into the host country and resettlement to a safe third country. 2. Voluntary repatriation/return of refugees into their country of origin, in safety and dignity, is based on their free will and an informed decision. 3. Local integration is aiming at providing the refugee with the permanent right to stay in the country of asylum. It follows the formal granting of refugee status by the country of asylum. In the EU context, the right to stay is temporary depending on the protection status (refugee status at least three years, subsidiary protection status at least one year). 4. Resettlement to a third country involves the assisted transfer of refugees from the country in which they have sought asylum to a safe third country that has agreed to admit them as refugees. This can be for permanent settlement or limited to a certain number of years. It is the third durable solution and it can only be considered once the two other solutions have proved impossible. 5. The European Union uses the concept of ‘durable solution’ in a narrower context. The EU resettlement framework provides for safe and legal pathways to the EU for vulnerable refugees whose need for international protection has been recognised and facilitates resettlement as a durable solution to those refugees that have no opportunity for voluntary return or local integration in the country of first asylum. For further information see European Commission: Communication on the managed entry in the EU of persons in need of international protection and the enhancement of the protection capacity of the regions of origin; ‘improving access to durable solutions’, COM(2004) 410 final. O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 165
Eastern Partnership (EAP) BG Източно партньорство CS Východní partnerství DE Östliche Partnerschaft EL Aνατολική Εταιρική Σχέση EN Eastern Partnership (EAP) ES Asociación Oriental Definition(s) An institutionalised forum for EU cooperation with its Eastern neighbours whose main goal is to create the necessary conditions to accelerate political association and further economic integration. Source(s) ET idapartnerlus Description of the Eastern Partnership on the Website of the European Union External Action FI itäinen kumppanuus Synonym(s) FR Partenariat oriental GA Comhpháirtíocht an Oirthir EAP Söderköping Process HR Istočno partnerstvo Broader term(s) HU Keleti Partnerség IT Partenariato Orientale European Neighbourhood Policy (ENP) Related term(s) LV Austrumu partnerība Black Sea Synergy Euro-Mediterranean Partnership (EUROMED) MT Sħubija mal-Lvant EMN Asylum and Migration Classification LT Rytų partnerystė NL Oostelijk Partnerschap 15.1 EU External dimension of migration and mobility PL Partnerstwo Wschodnie Euro Voc Classification PT Parceria Oriental RO Parteneriatul Estic SK Východné partnerstvo (EAP) SL Vzhodno partnerstvo SV östliga partnerskapet NO Det østlige partnerskapet (b); Det austlege partnarskapet (n) KA აღმოსავლეთი პარტნიორობა (EaP) UK Східне партнерство (СП) HY 166 Արևելյան գործընկերություն 10 European Union Note(s) 1. Within the context of the Eastern Partnership Platform 1 (democracy, good governance and stability), the Eastern Partnership Panel on Migration and Asylum (EaP) was created in 2011. The overall objective of the Panel is to strengthen the asylum and migration systems of Eastern partners and advance the dialogue on migration and asylum issues between the Eastern partners and the EU, as well as amongst the Eastern partners. 2. The precursor of the EaP was the Söderköping Process, which was launched in May 2001 as a cross-border cooperation on asylum and migration in order to respond to new challenges due to the EU’s enlargement eastwards. With the establishment of the Panel on Migration and Asylum within the Eastern Partnership’s Platform 1, the work of the Söderköping Process is being carried on within the multilateral dimension of the Eastern Partnership. 3. For more information, see the website of the EaP. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B economic migrant BG иконимически мигрант CS ekonomický migrant DE Wirtschaftsmigrant / Migrant aus wirtschaftlichen Gründen EL οικονομικός μετανάστης EN economic migrant ES persona migrante por motivos económicos ET majandusmigrant FI taloudellisten syiden vuoksi muuttava henkilö FR migrant économique GA imirceach eacnamaíoch HR ekonomski migrant HU gazdasági migráns IT migrante economico LT ekonominis migrantas LV ekonomiskais migrants MT Migrant(a) għal raġunijiet ekonomiċi NL economische migrant PL migrant ekonomiczny PT migrante económico C D Definition(s) A person who leaves their country of origin purely for economic reasons that are not in any way related to the refugee definition, in order to seek material improvements in their livelihood. E Source(s) G Synonym(s) H Broader term(s) I Narrower term(s) J F UNHCR Master Glossary of Terms economic refugee migrant guest worker migrant worker K Related term(s) L economic migration managed migration EMN Asylum and Migration Classification M Euro Voc Classification N 3.1 Migration for Economic Purposes 2811 migration O RO migrant economic SK ekonomický migrant SL ekonomski migrant SV ekonomisk migrant NO økonomisk migrant KA ეკონომიკური მიგრანტი Note(s) 1. Economic migrants do not fall within the criteria for refugee status and are therefore not entitled to benefit from international protection as refugees. 2. Economic migrants are sometimes referred to as economic refugees, but this is a misuse of the term ‘refugee’. Q R UK економічний мігрант HY P S տնտեսական միգրանտ T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 167
economic migration BG икономическа миграция CS ekonomická migrace DE Wirtschaftsmigration / Migration aus wirtschaftlichen Gründen EL οικονομική μετανάστευση Definition(s) Migration mainly for economic reasons or in order to seek material improvements to livelihood. Source(s) EN economic migration Derived by EMN from the definition of economic migrant in the UNHCR Master Glossary of Terms ES migración económica Broader term(s) ET majandusränne migration FI taloudellisista syistä tapahtuva muuttoliike Narrower term(s) FR migration économique labour migration GA imirce eacnamaíoch Related term(s) HR ekonomske migracije HU gazdasági (célú) migráció IT migrazione economica LT ekonominė migracija LV ekonomiskā migrācija MT Migrazzjoni għal raġunijiet ekonomiċi NL economische migratie economic migrant forced migration managed migration EMN Asylum and Migration Classification 3.1 Migration for Economic Purposes Euro Voc Classification 2811 migration PL migracja ekonomiczna PT migração económica RO migraţie economică SK ekonomická migrácia SL ekonomske migracije SV ekonomisk migration NO økonomisk migrasjon KA ეკონომიკური მიგრაცია UK економічна міграція HY 168 տնտեսական միգրացիա EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B emergency response system BG система за реакция при кризи C D Definition(s) CS systém reakce na mimořádné události DE Notfallsystem; Notfallklausel (EU acquis) EL σύστημα απόκρισης σε καταστάσεις έκτακτης ανάγκης EN emergency response system ES Sistema de respuesta de emergencia ET hädaolukordadele reageerimise süsteem FI hätäapujärjestelmä Provisional measures in the event of EU Member State(s) being confronted with an emergency situation characterised by a sudden inflow of third-country nationals including a distribution mechanism for asylum seekers in clear need of international protection to ensure a fair and balanced participation of all EU Member States. E Source(s) H Derived by EMN from Art. 78(3) TFEU and the European Agenda on Migration: Glossary, facts and figures FR mécanisme d’intervention d’urgence GA córas freagartha éigeandála HR sustav za odgovor na izvanredne situacije HU veszélyhelyzeti reagálási mechanizmus IT sistema di risposta all’emergenza LV ārkārtas reaģēšanas sistēma Narrower term(s) K Related term(s) L EMN Asylum and Migration Classification M relocation NL noodmaatregelmechanisme PL mechanizm interwencji kryzysowej 4. International Protection and other Types of Protection PT mecanismo de recolocação de emergência Euro Voc Classification RO sistem de intervenție de urgență SV nödsituationssystem NO nødinnsatssystem KA გადაუდებელი რეაგირების სისტემა UK система екстреного реагування HY շտապ իրավիճակների արձագանքման համակարգ N 2811 migration O Note(s) P SK systém núdzovej pripravenosti SL sistem odzivanja na izredne razmere I J emergency relocation plan MT Sistema ta’ rispons / ta’ intervent f’emerġenza G Synonym(s) emergency relocation LT skubaus atsako sistema F 1. These provisional measures are envisaged under Art.78 (3) of the Treaty on the Functioning of the European Union. 2. Under the distribution mechanism the receiving EU Member State will be responsible for the examination of an application for international protection in accordance with established rules and guarantees. The EU Commission has defined a redistribution key based on criteria such as GDP, size of population, unemployment rate and past numbers of asylum seekers. 3. The European Union Agency for Asylum (EUAA) uses the term ‹contingency plan› to refer to national plans detailing special measures to be taken in the event of a mass influx of migrants. This may be limited to the national asylum system or to migrants more generally. 4. Art. 33 of Regulation (EU) No 604/2013 (Dublin III Regulation) provides for two types of Member State emergency responses: “preventative action plans”, which should be operationalised when particular pressure on a Member State›s asylum system and/or problems in its functioning may jeopardise the application of the Dublin Regulation, and ‹crisis management action plans›, which should be operationalised if the ‹preventative action plan› does not remedy the problem. Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 169
emigrant BG емигрант CS vystěhovalec / emigrant DE Abwanderer / Auswanderer / Emigrant EL απόδημος / εξερχόμενος μετανάστης EN emigrant ES emigrante ET väljarändaja FI maastamuuttaja FR émigrant Definition(s) In the global context, a resident (national or alien) departing or exiting from one State intending to remain abroad for a period exceeding one year. In the EU context, a person who, having previously been usually resident in the territory of an EU Member State, ceases to have their usual residence in that EU Member State for a period that is, or is expected to be, of at least 12 months. Source(s) HU emigráns / kivándorló Global context: UN Recommendations on Statistics of International Migration EU context: Art. 2(c) and (g) of Regulation (EC) No 862/2007 (Migration Statistics Regulation) IT emigrante Broader term(s) GA eisimirceach HR iseljenik/emigrant LT emigrantas migrant LV emigrants Related term(s) MT Emigrant(a) NL emigrant PL emigrant PT emigrante RO emigrant SK vysťahovalec / emigrant SL izseljenec /emigrant SV utvandrare NO utvandrer KA ემიგრანტი UK емігрант HY 170 արտագաղթող (էմիգրանտ) immigrant emigration short-term migrant EMN Asylum and Migration Classification 3. Legal Migration Euro Voc Classification 2811 migration Note(s) 1. National legislation might understand different time limits in their definitions. 2. For the country of origin a person who leaves the country is an emigrant, for the country of destination, the same person is an immigrant, EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B emigration BG емиграция CS vystěhovalectví / emigrace DE Abwanderung / Auswanderung / Emigration EL αποδημία / μετανάστευση EN emigration ES emigración ET väljaränne FI maastamuutto FR émigration GA eisimirce C D Definition(s) In the global context, the act of departing or exiting from one State with the intention to remain abroad for a period exceeding one year. In the EU context, the action by which a person, having previously been usually resident in the territory of an EU Member State, ceases to have their usual residence in that EU Member State or another EU Member State for a period that is, or is expected to be, of at least 12 months. E Source(s) I IT emigrazione Global context: UN Recommendations on Statistics of International Migration EU context: Art. 2(c) and (g) of Regulation (EC) No 862/2007 (Migration Statistics Regulation) LT emigracija Broader term(s) HR iseljavanje HU emigráció / kivándorlás LV emigrācija MT Emigrazzjoni NL emigratie PL emigracja PT emigração RO emigraţie SK vysťahovalectvo / emigrácia SL izseljevanje /emigracija migration G H J K L Related term(s) emigrant immigration M EMN Asylum and Migration Classification N Euro Voc Classification O 3. Legal Migration 2811 migration P SV utvandring NO utvandring Q KA ემიგრაცია R UK еміграція HY F արտագաղթ (էմիգրացիա) S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 171
employee BG работник CS zaměstnanec DE Arbeitnehmer EL εργαζόμενος / υπάλληλος EN employee ES empleado ET töötaja FI työntekijä FR salarié GA fostaí HR zaposlenik HU alkalmazott / munkavállaló IT lavoratore dipendente LT darbuotojas LV darba ņēmējs / darbinieks MT Impjegat(a) NL werknemer Definition(s) Worker holding an explicit or implicit employment contract, which gives them a basic remuneration that is not directly dependent upon the revenue of the unit for which they work. Source(s) ILO Thesaurus Related term(s) employer employment self-employed person EMN Asylum and Migration Classification 3.1 Migration for Economic Purposes| 14.2 Economic factors and impacts (such as brain drain/gain, employment/ unemployment, labour market, economic growth, dumping) Euro Voc Classification 4406 employment PL pracownik PT empregado RO angajat SK zamestnanec SL zaposleni / delavec SV anställd NO ansatt (b); tilsett (n) KA დასაქმებული UK працівник HY 172 աշխատող EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B employer BG работодател CS zaměstnavatel DE Arbeitgeber EL εργοδότης EN employer ES empleador ET tööandja FI työnantaja FR employeur GA fostóir HR poslodavac HU munkáltató IT datore di lavoro LT darbdavys LV darba devējs MT Min iħaddem / Min jimpjega NL werkgever C D Definition(s) Any natural person or any legal entity, including temporary work agencies, for or under the direction and / or supervision of whom the employment is undertaken. Source(s) F Art. 2(e) of Council Directive 2009/52/EC (Employer Sanctions Directive) G Related term(s) H employee employment self-employed person I EMN Asylum and Migration Classification 3.1 Migration for Economic Purposes| 14.2 Economic factors and impacts (such as brain drain/gain, employment/ unemployment, labour market, economic growth, dumping) Euro Voc Classification 4406 employment J K L M PL pracodawca N PT empregador RO angajator O SK zamestnávateľ SL delodajalec P SV arbetsgivare NO arbeidsgiver (b); arbeidsgjevar (n) Q KA დამსაქმებელი R UK роботодавець HY E գործատու S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 173
employer sanction BG санкция на работодателя CS sankce vůči zaměstnavateli DE Arbeitgebersanktion / Sanktion gegen einen Arbeitgeber EL κύρωση κατά των εργοδοτών EN employer sanction ES sanción al empleador ET sanktsioonid tööandjale FI työnantajalle määrättävä seuraamus Definition(s) In the migration context, penalties, including fines, repayments to victims / the State and incarceration, imposed on employers by the EU Member State for breaking employment and / or migration rules. Source(s) Derived by EMN from Art. 5 and 7 of Council Directive 2009/52/EC (Employers Sanctions Directive) Related term(s) FR sanction à l’encontre d’un employeur illegal employment of an illegally staying third-country national GA smachtbhanna in aghaidh fostóra EMN Asylum and Migration Classification HR sankcija za poslodavca HU munkáltatók elleni szankciók IT sanzione nei confronti del datore di lavoro LT sankcijos darbdaviui LV darba devējam piemērojamās sankcijas MT Sanzjoni fuq min iħaddem / jimpjega 3.1 Migration for Economic Purposes| 14.2 Economic factors and impacts (such as brain drain/gain, employment/ unemployment, labour market, economic growth, dumping) Euro Voc Classification 2811 migration| 4406 employment NL sancties tegen werkgevers PL sankcja wobec pracodawcy PT sanção aplicada ao empregador RO sancţiune aplicată angajatorului SK sankcie voči zamestnávateľovi SL sankcije zoper delodajalca SV sanktion mot arbetsgivare NO sanksjon mot arbeidsgiver (b); sanksjon mot arbeidsgjevar (n) KA სანქცია დამსაქმებლის მიმართ UK санкції щодо роботодавця HY 174 գործատուի նկատմամբ կիրառվող տույժեր EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B employment BG заетост CS zaměstnání DE Beschäftigung EL απασχόληση / εργασία EN employment ES empleo C The exercise of activities covering whatever form of labour or work regulated under national law or in accordance with established practice for or under the direction and / or supervision of an employer. E Source(s) G ET töötamine Art. 2 (c) of Council Directive 2009/52/EC (Employer Sanctions Directive) FI työnteko Related term(s) FR emploi HR zapošljavanje employee employer occupation HU foglalkoztatás EMN Asylum and Migration Classification GA fostaíocht IT lavoro / impiego LT darbas LV nodarbinātība MT Impjieg / Xogħol NL tewerkstelling D Definition(s) F H I J 3.1 Migration for Economic Purposes| 14.2 Economic factors and impacts (such as brain drain/gain, employment/ unemployment, labour market, economic growth, dumping) Euro Voc Classification L M 4406 employment PL zatrudnienie N PT emprego RO angajare O SK zamestnanie SL zaposlovanje P SV anställning NO sysselsetting (b); sysselsetjing (n) Q KA დასაქმება R UK працевлаштування HY K զբաղվածություն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 175
enforcement measure BG принудителна мярка CS výkon rozhodnutí / výkonné opatření Definition(s) DE Vollstreckungsmaßnahme Any measure taken by the enforcing EU Member State with a view to implementing an expulsion decision. EL εκτελεστικό μέτρο Source(s) EN enforcement measure ES medida de ejecución ET sunnimeede FI täytäntöönpanotoimenpide FR mesure d’exécution GA beart forfheidhmiúcháin HR izvršna mjera HU végrehajtási intézkedés IT misura di esecuzione LT vykdymo priemonė LV izpildes pasākums Art. 2(c) of Council Directive 2001/40/EC (Expulsion Directive) Related term(s) expulsion expulsion decision return decision EMN Asylum and Migration Classification Euro Voc Classification 2811 migration Note(s) In IE, this phrase is used in a more global sense for all forms of removal. MT Miżura ta’ infurzar NL uitvoeringsmaatregel PL środek wykonawczy PT medida de execução RO măsură de aplicare SK vykonávacie opatrenie SL izvršilni ukrep SV verkställighetsåtgärd NO iverksettelsestiltak (b); iverksetjingstiltak (n) KA აღსრულების ღონისძიება UK захід примусового виконання HY 176 հարկադիր կատարման միջոց EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B entry ban C BG забрана за влизане CS zákaz vstupu DE Einreiseverbot EL απαγόρευση εισόδου EN entry ban ES prohibición de entrada An administrative or judicial decision or act prohibiting entry into and stay in the territory of the EU Member States for a specified period, accompanying a return decision. E Source(s) G ET sissesõidukeeld Art. 3(6) of Council Directive 2008/115/EC (Return Directive) FI maahantulokielto Synonym(s) FR interdiction d’entrée (EU acquis, BE, LU); interdiction d’entrée sur le territoire (LU); interdiction de retour sur le territoire (IRTF) (FR) GA toirmeasc ar iontráil D Definition(s) H re-entry ban I Euro Voc Classification 2811 migration J HR zabrana ulaska i boravka K HU beutazási tilalom IT divieto di ingresso L LT draudimas atvykti LV ieceļošanas aizliegums M MT Dħul miżmum // Inibizzjoni fuq id-dħul NL inreisverbod N PL zakaz wjazdu O PT interdição de entrada RO interdicţie de intrare P SK zákaz vstupu SL prepoved vstopa Q SV inreseförbud NO innreiseforbud (b); innreiseforbod (n) R KA შესვლის აკრძალვა UK заборона на в’їзд HY F S մուտքի արգելք T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 177
Entry/Exit System (EES) BG Система вход/изход CS Systém vstupu/výstupu DE Einreise-/Ausreisesystem EL σύστημα εισόδου/εξόδου EN Entry/Exit System (EES) ES Sistema de Entradas y Salidas ET riiki sisenemise ja riigist lahkumise süsteem FI rajanylitystietojärjestelmä (EES) FR système d’entrée/sortie (EES) GA Córas dul isteach/imeachta HR Sustav ulaska/izaska (EES) HU határregisztrációs rendszer (EES) Definition(s) System which registers entry and exit data and refusal of entry data of third-country nationals crossing the external borders of the Schengen States. Source(s) Derived by EMN from Regulation (EU) 2017/2226 (Regulation establishing an Entry/Exit System (EES)) Synonym(s) EES Broader term(s) Smart Borders Package Related term(s) IT Sistema di ingres-si/uscite European Travel Information and Authorisation System (ETIAS) LT Atvykimo ir išvykimo sistema EMN Asylum and Migration Classification LV ieceļošanas/izceļošanas sistēma MT Sistema ta’ Dħu/ta’ Ħruġ NL inreis-uitreissysteem PL System Wjazdu/Wyjazdu PT Sistema de Entrada/Saída RO sistem de intrare/ieșire SK systém vstupu/výstupu (EES) SL sistem vstopa/izstopa SV in- och utresesystem NO ankomst-/avreisesystem (b); innkomst-/avreisesystem (n) KA შესვლა-გასვლის სისტემა (EES) UK Система в’їзду/виїзду (EES) HY 178 մուտքի / ելքի համակարգ 6.1.3 Schengen governance Euro Voc Classification 2811 migration Note(s) 1. The EES aims to improve the management of external borders, to reduce irregular migration by addressing the phenomenon of overstaying, and to facilitate the management of migration flows. In addition, it aims to contribute to the fight against terrorism and serious crime and to ensure a high level of internal security. 2. The EES applies to third-country nationals, both those requiring a visa and those visa-exempt, admitted for a short stay of 90 days in any 180-day period. It also applies to those that have been refused entry. It stores information on their identity and on their travel documents, as well as certain biometric data. 3. The Regulation determines the conditions of access to the system for law enforcement purposes. The information stored in the EES is accessible to border authorities, visa authorities and the authorities within the Schengen Member States competent to check if a third-country national fulfils the conditions of entry or stay. The data are also available to the designated authorities and Europol, to prevent, detect and investigate terrorist offences or other serious crimes, according to conditions as set out in the regulation. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 179
environmental migrant BG CS environmentální migrant Definition(s) ES migrante por motivos medioambientales A person who, for compelling reasons of sudden or progressive changes in the environment that adversely affect their life or living conditions, is obliged to leave their habitual home, or chooses to do so, either temporarily or permanently, and who moves either within their country or across an international border. ET keskkonnapõgenik Source(s) DE Umweltmigrant EL περιβαλλοντικός μετανάστης EN environmental migrant FI ilmastosiirtolainen/ilmastomuuttaja (no established translation) Derived by EMN from IOM: Environmental Migrants and Global Governance: Facts, Policies and Practices, 2017 FR migrant environnemental Broader term(s) GA migrant HR migrant zbog klimatskih promjena Related term(s) HU környezeti migráns environmentally displaced person IT migrante ambientale EMN Asylum and Migration Classification LT aplinkos pokyčio migrantas LV vides migrants MT Migrant/a ambjentali NL PL migrant klimatyczny PT migrante ambiental RO migrant de mediu SK environmentálny migrant SL okoljski migrant SV miljömigrant NO miljømigrant KA ეკოლოგიური მიგრანტი UK екологічний мігрант HY 180 3.4 Migration for other Reasons| 14.5 Environmental factors and Impacts Euro Voc Classification 2811 migration| 52 Environment Note(s) 1. There is currently no international agreement on the terminology used to describe persons or groups of persons that move for environment-related reasons. 2. Environmental migration is often caused by multiple factors, making the cause-consequence relationships complex and multifactorial. The different degrees of force and influencing factors make it challenging to categorise these movements as either migration or displacement, particularly in the case of people fleeing disasters and environmental degradation. The selected IOM definition is deliberately broad and flexible in order to account for the diverse range of population movements due to all types of environmental drivers. It includes different forms of environmental movements: forced displacement and voluntary (anticipatory) migration, temporary and permanent, internal and international, individual and collective, of proximity and of long distance. The nature, duration and scale of environmental migration also depends on whether it takes place in the context of slow-onset events and processes (sea level rise, increasing temperatures, land degradation, etc) or sudden-onset events and processes (floods, cyclones, storms, etc.) or human-made environmental degradation (such as deforestation, pollution) and disasters (such as nuclear or industrial accidents) that are exacerbated by the adverse effects of climate change and environmental degradation. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D 3. A distinction is made between environmental migrants and environmentally displaced persons. The latter refers to individuals forced to migrate due to sudden-onset events, gradual or slow-onset climate change, or human-induced environmental degradation and disasters. This forced migration occurs when the scale of the impact of the environmental disaster exceeds the ability of the affected community or society to cope with it using its own resources. This definition of disaster from the Nansen Initiative serves as the basis for distinguishing between environmental displacement and migration. Crucial to the distinction is the strict categorisation of environmentally displaced persons in the context of forced migration, which is consistent with the definition of displacement. For more information see: IOM: Environmental Migrants and Global Governance:Facts, Policies and Practices, 2017. 4. While some sources refer to environmentally displaced persons as environmental refugees, this is considered to be a misuse of the term ‘refugee’ as they do not meet the definition of refugees in the strict sense of Art. 1A of the Geneva Refugee Convention and Protocol. For more information see: UNHCR: Legal considerations regarding claims for international protection made in the context of the adverse effects of climate change and disasters, 2020. 5. For more information see: Council of Europe, Parliamentary Assembly: Environmentally induced migration and displacement: a 21st-century challenge,- Resolution 1655 (2009) and EMN inform: Displacement and migration related to disasters, climate change and environmental degradation, 2023. E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 181
environmentally displaced person BG разселено лице по екологични причини CS environmentální uprchlík Definition(s) DE Umweltvertriebener A person subject to forced migration as a result of sudden, drastic environmental changes. EL εκτοπισμένο άτομο για περιβαλλοντικούς λόγους Source(s) EN environmentally displaced person ES población desplazada por motivos medioambientales ET keskkonnapõhjustel ümberasustatud isik FI ympäristötekijöiden vuoksi siirtymään joutunut henkilö (not in general use) FR personne déplacée pour des raisons environnementales GA duine easáitithe de dheasca dálaí comhshaoil HR osoba raseljena zbog ekoloških razloga Derived by EMN from the definition for ‘environmental refugee’ in the UNHCR International Thesaurus of Refugee Terminology Synonym(s) environmental refugee environmentally-driven migrant Broader term(s) displaced person environmental migrant HU lakóhelyét környezeti okból elhagyni kényszerült személy Related term(s) IT sfollato per motivi ambientali EMN Asylum and Migration Classification LT dėl aplinkos pokyčių priverstas persikelti asmuo LV vides faktoru ietekmē pārvietota persona MT Persuna sfollata għal raġunijiet ambjentali NL door milieufactoren verdreven ontheemde (not commonly used in NL, BE) PL osoba przesiedlona w wyniku katastrofy naturalnej PT deslocado ambiental RO persoană strămutată din cauze legate de mediul înconjurător internally displaced person 1. Framework Concepts on Migration (including root causes of migration| 14.5 Environmental factors and Impacts Euro Voc Classification 2811 migration| 5216 deterioration of environment Note(s) Environmentally displaced persons are sometimes referred to as environmental refugees, but this is a misuse of the term ‘refugee’ as they are not refugees in the strict sense of Art. 1A of the Geneva Refugee Convention and Protocol, although their migration is forced. SK osoba vysídlená z environmentálnych dôvodov SL okoljsko razseljena oseba SV person som fördrivits på grund av miljökatastrof NO person fordrevet på grunn av miljøskader (b); person fordriven på grunn av miljøskader (n) KA ეკოლოგიური მიზეზებით გადაადგილებული პირი UK особа, переміщена з екологічної причини / екологічний мігрант HY 182 էկոլոգիական պաճառներով տեղահանված անձ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B equality of arms C BG равни процесуални възможности D Definition(s) CS rovnost zbraní In the context of international protection and with regard to access to information, legal or procedural re-quirement to ensure that an applicant for international protection, a legal representative and all higher instances have access to all the information on which a decision on international protection is based, to ensure transparency and fairness in international protection procedures. DE Waffengleichheit EL ισότητα των όπλων EN equality of arms ES igualdad de armas ET poolte võrdsus FI oikeuskeinojen tasapuolisuus Source(s) FR égalité des armes E F G H I HU fegyveregyenlőség Derived by EMN from EUAA-CdT terminology project, IATE and ACCORD: Recherching Country of Origin information, training manual.- 2013 edition, 2013 IT Parità delle armi GA comhionannas arm HR jednakost oružja J Synonym(s) LT šalių procesinis lygiateisiškumas principle of equality of arms K LV tiesību vienlīdzība EMN Asylum and Migration Classification L MT Aċċess ugwali għall-informazzjoni u d-deċiżjonijiet NL recht op gelijke proceskansen (NL), wapengelijkheid (BE) PL zasada równości praw stron postępowania PT igualdade de armas RO egalitatea de arme SK rovnosť zbraní SL enakost orožij SV jämlikhet i medel NO likeverdige prosessvilkår KA მხარეთა თანასწორობა UK рівність сторін HY սկզբունք, որը յուրաքանչյուր կողմի թույլ է տալիս ապահովել արդարացի հավասարություն, իրավունքների իրացում 2.3 Regional and Transnational (e.g. European Convention of Human Rights) M Euro Voc Classification 12 Law| 1236 rights and freedoms N Note(s) O 1. The concept has been created by the European Court of Human Rights (ECtHR) in the context of the right to a fair trial (Art.6 of the European Convention of Human Rights (ECHR). Equality of arms requires that there be a fair balance between the opportunities afforded the parties involved in litigation (for example, each party should be able to call witnesses and cross-examine the witnesses called by the other party). The principles means that the same procedural rights are to be provided to all the parties unless distinctions are based on law and can be justified on objective and reasonable grounds, not entailing actual disadvantage or other unfairness to the defendant. 2. The European Union has stipulated the right of access to information for legal assistance of the applicant in Art. 19 of Directive 2013/32/EU (Recast Asylum Procedures Directive. 3. The application of the principle of equality of arms means that even restricted information, when used as a basis for findings of fact in the international protection decision, should be made available to the applicant and legal representatives. P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 183
establishment of identity BG установяване на самоличност CS určení totožnosti jednotlivců v souvislosti s řízením o mezinárodní ochraně DE Identitätsfeststellung EL εξακρίβωση της ταυτότητας EN establishment of identity ES determinación de la identidad ET isikutuvastamine rahvusvahelise kaitse menetluses FI henkilöllisyyden selvittäminen FR établissement de l’identité GA aitheantas daoine faoi chosaint idirnaisiúnta a dhearbhú HR utvrđivanje identiteta HU személyazonosság megállapítása IT determinazione dell’identità LT prieglobsčio prašytojo tapatybės nustatymas LV pieteikuma iesniedzēja, kas lūdz starptautisko aizsardzību, identitātes noteikšana MT Konferma tal-identità Definition(s) Process which is commonly carried out for identification and identity-verification purposes in difference procedures on the basis of a review of documentary evidence, but which makes use of different procedures and methods when documentary evidence is inauthentic, inadequate, insufficient or absent. Source(s) Derived by EMN on the basis of the EMN Focussed Study: Establishing identitiy for international protection: Challenges and Practices, 2013 and EMN FOcussed Study: Challenges and practices for establishing applicants› identity in the migration process, 2017. Synonym(s) establishment of identity for international protection establishment of identity of individuals in international protection procedures origin verification Narrower term(s) PL ustalenie tożsamości wnioskującego o udzielenie ochrony międzynarodowej age assessment identification verification of identity language analysis for the determination of origin (LADO) PT estabelecimento de identidade EMN Asylum and Migration Classification NL het vaststellen van de identiteit RO stabilirea identității SK zisťovanie totožnosti jednotlivcov na účely medzinárodnej ochrany 6.3.2. Establishment of identity of applicants for international protection (incl. examination of documents, language analysis, age assessment) SL ugotavljanje istovetnosti / ugotavljanje identitete Euro Voc Classification SV fastställande av identitet 12 Law| 2811 migration NO fastsettelse av identiteten (b) / fastsetjing av identiteten (n) KA ვინაობის დადგენა UK встановлення особи HY 184 ինքնության հաստատում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. As there is no universally agreed definition of identity and no legal definition common to all EU Member States, most EU Member States use practical definitions which at the minimum establish the first name, surname, sex, date of birth and nationality of the applicant. 2. This definition covers all procedures for which the establishment of identity is relevant (such as legal migration, visa, border control, international protection, return, residence and work permits, family reunification and naturalisation. 3. The tools used for the establishment of identity are, e.g. physical-technical examinations of the documents presented, investigations in the contry of origin via the embassies, DNA test, retinal scanning, taking of finger prints, language analysis for the determination of origin (LADO) and age assessment. 4. Identification: The identification procedure/system aims to answer the question: “Who is this person?’Biometric identification systems are characterised as 1-to-n matching systems where n is the total number of biometrics in the database against which the person’s biometric characteristics are checked. Identification procedures and systems (e.g. biometric systems) are different from identity verification systems in that they seek to identify an unknown person or biometric. 5. Identity verification: Identity verification procedures and systems seek to answer the question: “Is this person who they say they are?’Biometric verification systems are generally described as 1-to-1 matching systems because they try to match the biometric presented by the individual against a specific biometric already on file. 6.The EMN Study ‘Challenges and practices for establishing applicants’ identity in the migration process, 2017’ examines (EU Member) States approaches to establish the identity of third-country nationals within the migration process in a broad sense, covering both identification and identity-verification related tasks. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 185
ethnic cleansing BG етничеко прочистване CS etnická čistka DE ethnische Säuberung EL εθνική εκκαθάριση / εθνοκάθαρση EN ethnic cleansing ES limpieza étnica Definition(s) Rendering an area ethnically homogeneous by using force or intimidation to remove from a given area persons of another ethnic or religious group, which is contrary to international law. Source(s) FI etninen puhdistus UN Security Council: Final Report of the Commission of Experts established Pursuant to Security Council Resolution 780 (1992) FR nettoyage ethnique Related term(s) ET etniline puhastus GA glanadh eitneach genocide HR etničko čišćenje EMN Asylum and Migration Classification HU etnikai tisztogatás IT pulizia etnica LT etninis valymas LV etniskā tīrīšana MT Tindif etniku NL etnische zuivering PL czystki etniczne PT limpeza étnica RO purificare etnică SK etnické čistky SL etnično čiščenje SV etnisk rensning NO etnisk rensing (b); etnisk reinsing (n) KA ეთნიკური წმენდა UK етнічна чистка HY 186 էթնիկ զտում 1. Framework Concepts on Migration (including root causes of migration| 14. Factors and Impacts of Migration Euro Voc Classification 1231 international law Note(s) 1. General Assembly resolution 47/121: The situation in Bosnia and Herzegowina referred in its Preamble to ‘the abhorrent policy of “ethnic cleansing”’. 2. Trial Chamber Judgment of 2 August 2001 of the International Criminal Tribunal for the former Yugoslavia (ICTY) has observed, while ‘there are obvious similarities between a genocidal policy and the policy commonly known as “ethnic cleansing”’, yet ‘a clear distinction must be drawn between physical destruction and mere dissolution of a group. The expulsion of a group or part of a group does not in itself suffice for genocide’. 3. These legal documents thus state that crimes committed during an ethnic cleansing are similar to those of genocide, but while genocide includes an intent at complete or partial destruction of the target group, ethnic cleansing may involve murder only to the point of mobilising the target group out of the territory. Hence, there may be varied degrees of mass murder in an ethnic cleansing, often subsiding when the target group appears to be leaving the desired territory, while during genocide the mass murder is ubiquitous and constant throughout the process, continuing even while the target group tries to flee. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B ethnic nationality BG етническа националност CS národnost C D Definition(s) DE ethnische Zugehörigkeit A synonym of ethnicity or nationality, used in some EU Member States in addition to citizenship. E EL εθνοτική καταγωγή Source(s) F EN ethnic nationality ES origen étnico ET rahvus FI etninen tausta FR origine ethnique GA náisiúntacht eitneach HR nacionalna pripadnost HU nemzetiség IT nazionalità etnica LT tautybė / etninė kilmė LV tautība MT Nazzjonalità etnika NL etniciteit / etnische achtergrond / etnische afkomst PL narodowość etniczna PT origem étnica RO naţionalitate etnică / origine etnică Towards Harmonised European Statistics on International Migration (THESIM) project G Synonym(s) ethnicity nationality H Related term(s) I citizenship minority J EMN Asylum and Migration Classification K 14. Factors and Impacts of Migration Euro Voc Classification 1231 international law L Note(s) M 1. Ethnic nationality is often a self-declared adhesion to a specific ethnic group and this information is collected at a census but also sometimes in administrative registration. 2.This concept should not be confused with citizenship. SK národnosť SL narodnost / etnična pripadnost O P SV tillhörighet till etnisk grupp NO etnisk tilhørighet (b); etnisk tilhøyrsle (n) Q KA ეთნიკური კუთვნილება R UK національність HY N էթնիկ ծագում S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 187
EU Action Plan on Return BG План за действие на ЕС относно връщането CS Akční plán EU v oblasti navracení Definition(s) DE EU-Aktionsplan für die Rückkehr / EU-Aktionsplan für die Rückführung / EU-Rückkehr-Aktionsplan A document presenting a series of concrete actions to enable EU Member States and the European Union to further improve the effectiveness of their return system. EL Σχέδιο δράσης της ΕΕ για την επιστροφή Source(s) EN EU Action Plan on Return ES Plan de Acción de la UE para el retorno ET ELi tagasisaatmisalane tegevuskava FI Palauttamista koskeva EU:n toimintaohjelma FR plan d’action de l’UE en matière de retour GA Plean Gníomhaíochta an Aontais Eorpaigh maidir le filleadh HR EU Akcijski plan o vraćanju HU a visszatérésre vonatkozó uniós cselekvési terv IT Piano d’Azione dell’UE sul rimpatrio LT ES veiksmų grąžinimo srityje planas LV ES Rīcības plāns par atgriešanu MT Pjan (Il-) t’ Azzjoni tal-EU għar-Ritorn NL EU Actieplan inzake terugkeer PL Plan Działań UE w zakresie Powrotów European Commission: Communication: EU Action Plan on return, COM(2015) 453 final Broader term(s) return Euro Voc Classification 0431 politics and public safety| 1011 European Union law Note(s) 1. The first EU Action Plan on Return was adopted by the European Commission on 9 September 2015. It focused on the following two key priorities: ƒ increasing the effectiveness of the EU system to return irregular migrants ƒ enhancing cooperation on readmission with countries of origin and transit. 2. It was followed by the renewed action plan in 2017, for further information see: European Commission: Communication on a more effective return policy in the European Union - a renewed Action Plan on Return, COM(2017) 200 final PT Plano de Ação da UE em matéria de regresso RO Planul de acțiune al UE privind returnarea SK Akčný plán EÚ v oblasti návratu SL Akcijski načrt EU o vračanju SV EU:s handlingsplan för återvändande NO EUs handlingsplan for retur KA ევროკავშირის სამოქმედო გეგმა მიგრანტთა დაბრუნების შესახებ UK План дій ЄС із повернення HY 188 ԵՄ վերադարձի վերաբերյալ գործողությունների ծրագիր EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B EU Blue Card BG синя карта на ЕС CS modrá karta EU DE Blaue Karte EU EL μπλε κάρτα της Ε.Ε. EN EU Blue Card ES tarjeta azul UE C D Definition(s) The residence permit bearing the term EU Blue Card entitling its holder to reside and work in the territory of a EU Member State under the terms of Directive 2021/1883 (Recast Blue Card Directive) . E Source(s) G ET Euroopa Liidu sinine kaart Art. 2(3) of Directive (EU) 2021/1883 (Recast Blue Card Directive) FI EU:n sininen kortti Narrower term(s) FR carte bleue européenne GA cárta gorm an AE HR EU plava karta HU EU Kék Kártya IT Carta blu UE LT ES mėlynoji kortelė LV ES zilā karte MT Karta (Il-) Blu tal-UE NL Europese blauwe kaart / EU Blue Card PL Niebieska Karta UE PT cartão azul UE RO Cartea Albastră a UE SK modrá karta Európskej únie / modrá karta EÚ SL modra karta EU SV EU-blåkort NO EU-blåkort KA ევროკავშირის ლურჯი ბარათი UK Блакитна картка ЄС HY ԵՄ կապույտ քարտ EU Blue Card holder F H I Related term(s) highly qualified employment highly qualified migrant residence permit J K EMN Asylum and Migration Classification 3.1 Migration for Economic Purposes L Euro Voc Classification 1011 European Union law| 4406 employment M Note(s) N 1. An EU Blue Card gives highly-qualified workers from outside the EU the right to live and work in an EU country, provided they have higher professional qualifications, such as a university degree, and an employment contract or a binding job offer for at least one year with a high salary compared to the average in the EU country where the job is. Third-country nationals can stay and work for a period of between one and four years in the EU Member State who granted them the EU Blue Card. The EU Blue Card applies in 25 of the 27 EU countries. It does not apply in DK and IE. 2. Directive 2011/95/EU (Recast Qualification Directive) outlines the rights of beneficiaries of international protection, including access to the labour market in the EU Member State that granted them international protection. Highly qualified beneficiaries of international protection are entitled to apply for an EU Blue Card in other EU Member States to improve their job opportunities across the European Union. In those Member States, they would be subject to the same rules as other third-country nationals under the EU Blue Card Directive. However, this should not affect their status in the EU Member State that originally granted them international protection. Additionally, beneficiaries of international protection are also entitled to apply for an EU Blue Card in the EU Member State that granted them protection, but in such cases, certain provisions related to equal treatment and family reunification do not apply for legal clarity and coherence. 3. Art.9(4) of the Recast EU Blue Card Directive stipulates that when an EU Member State issues an EU Blue Card to a third-country national who has been granted international protection by that EU Member State, the issued EU Blue Card should include a remark under the heading ‘Remarks’ stating: “International protection granted by [name of the EU Member State] on [date].” If the EU Member State later withdraws the international protection granted to the EU Blue Card holder, it should, when appropriate, issue a new EU Blue Card without this remark. Furthermore, according to Art. 9(5) of the same Directive, when an EU Blue Card is issued by an EU Member State to a third-country national who is a beneficiary of international protection in another EU Member State, the issued EU Blue Card should contain a remark under the heading ‘Remarks’ stating: “International protection granted by [name of the EU Member State] on [date].” 4. EU Member States are required to issue a residence permit, in line with Council Regulation (EC) No 1030/2002, to EU Blue Card holders who meet the conditions specified in Art. 18 of this Directive for obtaining EU long-term resident status. The residence permit mentioned in Par. 1 shall include, under the heading ‘remarks,’ the notation ‘Former EU Blue Card holder’ as entered by EU Member States. EMN ASYLUM AND MIGRATION GLOSSARY 10.0 189 O P Q R S T U V W X Y Z
EU Blue Card holder BG притежател на синя карта на ЕС CS držitel modré karty EU DE Inhaber einer Blauen Karte EU EL κάτοχος μπλε κάρτας της ΕΕ EN EU Blue Card holder ES titular de la tarjeta azul UE ET Euroopa Liidu sinise kaardi omanik Definition(s) A third-country national who has acquired a residence permit bearing the term ‘EU Blue Card’ entitling them to reside and work in the territory of an EU Member State under the terms of Directive (EU) 2021/1883( Recast Blue Card Directive). Source(s) FI EU:n sinisen kortin haltija Derived by EMN from Art. 2(3) of Directive (EU) 2021/1883 (Recast Blue Card Directive) FR titulaire d’une carte bleue européenne Broader term(s) GA sealbhóir chárta gorm an AE EU Blue Card HR nositelj EU plave karte Related term(s) HU EU Kék Kártya tulajdonos highly qualified migrant IT titolare di Carta blu UE EMN Asylum and Migration Classification LT ES mėlynosios kortelės turėtojas 3.1 Migration for Economic Purposes LV ES zilās kartes turētājs Euro Voc Classification MT Portatur(-triċ) (Il-) tal-Karta Blu tal-UE 1011 European Union law| 4406 employment NL houder van een Europese blauwe kaart PL posiadacz Niebieskiej Karty UE PT titular do cartão azul UE RO posesor de Carte Albastră UE SK držiteľ modrej karty Európskej únie / držiteľ modrej karty EÚ SL imetnik modre karte EU SV innehavare av EU-blåkort NO innehaver av EU-blåkort (b); innehavar av EU blåkort (n) KA ევროკავშირის ლურჯი ბარათის მფლობელი UK власник Блакитної картки ЄС HY 190 ԵՄ կապույտ քարտապան EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B EU Immigration Portal BG Имиграционен портал на ЕС CS Imigrační portál EU DE EU-Zuwanderungsportal / EU-Einwanderungsportal EL Διαδικτυακή Πύλη της ΕΕ για τη Μετανάστευση EN EU Immigration Portal ES Portal de la Inmigración de la UE ET ELi sisserändeportaal FI EU:n maahanmuuttoportaali FR Portail de l’UE sur l’immigration GA Tairseach Inimirce AE HR Imigiracijski portal EU-a HU uniós bevándorlási portál IT Portale europeo dell’immigrazione LT ES imigracijos portalas LV ES Imigrācijas portāls MT Portal (Il-) tal-UE dwar l-Immigrazzjoni NL EU-portaalsite over immigratie PL Portal Imigracyjny UE PT Portal da Imigração da UE RO Portalul UE privind imigrația SK Imigračný portál EÚ SL Portal EU o priseljevanju C D Definition(s) A website with hands-on information for foreign nationals interested in moving to the European Union acting as a first point of entry for providing up-to-date, practical information on EU and national immigration procedures and policies. Source(s) Developed by the EMN E F G H Synonym(s) EUIP I Broader term(s) immigration J Related term(s) European Migration Network (EMN) K EMN Asylum and Migration Classification 3. Legal Migration| 14.4 Technological factor and impacts (digitalization of processes v paper processes) L Euro Voc Classification M 1011 European Union law| 2811 migration N Note(s) 1. The EU Immigration Portal was launched in November 2011 (see European Commission Press Release IP/11/1370 of 18 November 2011). 2. For more information, see the website of the EU Immigration Portal. SV EU:s invandringsportal O P NO Informasjonsportal om innvandring til EUs medlemsland Q KA ევროკავშირის საიმიგრაციო პორტალი R UK Імміграційний портал ЄС HY S ԵՄ ներգաղթի (իմիգրացիայի) պորտալ T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 191
EU skills profile tool for third-country nationals BG Инструмент на ЕС за профилиране на уменията на гражданите на трети държави CS (EU) nástroj pro tvorbu dovednostního profilu státních příslušníků třetích zemí DE EU-Instrument zur Erstellung von Kompetenzprofilen für Drittstaatsangehörige EL Ενωσιακό εργαλείο κατάρτισης προφίλ δεξιοτήτων για υπηκόους τρίτων χωρών EN EU skills profile tool for third-country nationals ES Herramienta de la UE para crear el perfil de capacidades de nacionales de terceros países ET ELi vahend kolmandate riikide kodanike kutsekirjelduse koostamiseks FI EU:n taitoprofiilityökalu kolmansien maiden kansalaisille FR outil européen de profilage des compétences des ressortissants de pays tiers GA Uirlis an Aontais Eorpaigh um Próifíliú Scileanna do Náisiúnaigh Tríú Tíortha HR Alat EU-a za profiliranje vještina državljana trećih zemalja HU A harmadik országbeli állampolgárok uniós készségprofil-készítő eszköze IT Strumento europeo di determinazione delle competenze per i cittadini di paesi terzi LT įgūdžių nustatymo ES šablonas MT Għodda tal-UE għall-Profili tal-Ħiliet għaċ-Ċittadini ta’ Pajjiżi Terzi / Għodda għall-Profili tal-Ħiliet għaċ-Ċittadini ta’ Pajjiżi Terzi / Sett ta’ Għodda għall-Ħiliet għaċ-Ċittadini ta’ Pajjiżi Terzi NL EU-instrument voor het opstellen van een vaardigheidsprofiel voor onderdanen van derde landen PL unijne narzędzie do tworzenia profilu umiejętności obywateli państw trzecich PT ferramenta de definição de perfis de competências da UE para nacionais de países terceiros RO Instrument de profil al competențelor UE pentru resortisanții țărilor terțe SK nástroj EÚ na stanovenie profilu zručností štátnych príslušníkov tretích krajín SL orodje EU za profiliranje znanj in spretnosti državljanov tretjih držav SV verktyg för kartläggning av kompentensen hos personer från länder utanför EU NO EUs kvalifikasjonskartleggings- og registreringsverktøy KA ევროკავშირის ინსტრუმენტი მესამე ქვეყნის მოქალაქეთა კვალიფიკაციების აღწერისთვის UK Інструмент ЄС для підготовки профілю професійних навичок для громадян третіх країн HY LV ES prasmju profila noteikšanas rīks trešo valstu valstspiederīgajiem 192 EMN ASYLUM AND MIGRATION GLOSSARY 10.0 երրորդ երկրների քաղաքացիների համար ԵՄ հմտությունների պրոֆիլի գործիք
A B C D Definition(s) E Multilingual online tool which supports the early identification and documentation of skills, qualifications and work experiences of third-country nationals and which serves as a basis for issuing personalised advice on further steps towards labour market and societal integration. F G Source(s) H EU Skills Profile Tool for Third Country Nationals EMN Asylum and Migration Classification I 3.1 Migration for Economic Purposes| 8.2 Access to employment| 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) J Euro Voc Classification 2811 migration| 4406 employment K Note(s) L 1. As part of the Skills Agenda for Europe, the European Commission developed the Skills Profile Tool in 2017 to support early profiling of the skills of third-county nationals (e.g. applicants for international protection, refugees, migrants). The tool was updated in February 2020 and will soon become an integral part of the new Europass platform, launched on 1 July 2020. For more information see Skills and Qualifications on the Website of DG Employment, Social Affairs and Inclusion, https://ec.europa.eu/social/main.jsp?langId=en&catId=1412. 2. The tool is intended for use by organisations offering assistance to third-country nationals. It helps to map the skills, qualifications and work experiences of third-country nationals and to give them personalised advice on further steps, e.g. a referral to recognition of diplomas, skills validation, further training or employment support services. To facilitate its use among third-country nationals, a video tutorial has been created and the website has been translated into all EU languages (except Irish), as well as into Arabic, Farsi, Pashto, Sorani, Somali, Tigrinya and Turkish. 3. The European Commission and the European Training Foundation (ETF) developed together with EU Member States the European inventory on validation of non-formal and informal learning, which is a regularly updated overview of validation practices and arrangements across Europe. The inventory was endorsed by the Council recommendation of 20 December 2012 on the validation of non-formal and informal learning and works together with the European guidelines for validating non-formal and informal learning 2009 as a tool to sup-port countries in developing and implementing validation arrangements. M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 193
EU Talent Pool BG резерв на ЕС от таланти CS EU Talent Pool / rezervoár talentů EU DE EU-Talentpool EL Δεξαμενή Ταλέντων της ΕΕ EN EU Talent Pool ES reserva de talentos de la UE ET ELi talendireserv FI EU:n osaajareservi FR réservoir européen de talents GA Linn Tallainne an Aontais Eorpaigh HR baza talenata EU HU EU Tehetségbázis IT LT ES talentų bazė LV ES talantu fonds MT Riserva ta’ Talenti fl-UE NL EU-talentenpool PL Europejska Pula Talentów PT Reserva de talentos da UE Definition(s) EU-wide platform for international recruitment through which skilled third-country nationals could express their interest in migrating to the EU, and could be identified by EU migration authorities and employers based on their need. Source(s) Derived by EMN from European Commission: Communication on a New Pact on Migration and Asylum, COM(2020) 609 final Synonym(s) Talent Pool Broader term(s) economic migration Related term(s) talent partnership EMN Asylum and Migration Classification 3.1 Migration for Economic Purposes| 8.2 Access to employment Euro Voc Classification 2811 migration| 4406 employment RO Rezerva de talente din UE / Fondul de talente din UE SK Okruh talentov EÚ (EU acquis) / EU Talent Pool SL nabor talentov EU SV EU-talangreserv NO EUs talentbase KA სწავლისა და დასაქმებისთვის კვალიფიციურ მიგრანტთა ევროკავშირის პლატფორმა UK Фонд талантів ЄС HY 194 ԵՄ տաղանդների ֆոնդ Note(s) 1. The EU Talent Pool is one of the key deliverables of the EU’s New Pact on Migration and Asylum, which aims to attract talent to the EU and support integration in local communities. 2. On 10 October 2022 the European Commission launched the EU Talent Pool pilot initiative, a new online job search tool to help those fleeing Russia’s invasion of Ukraine with securing employment in the European Union. The new tool is available in English, Ukrainian and Russian, and accessible via the European Labour Authority›s EURES portal. 3. For more information see the Webpage of the EU Commission on Skills and Talent. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
EU-LAC Structured Dialogue on Migration BG Структурен диалог по въпросите на миграцията между ЕС и страните от Латинска Америка A B C D Definition(s) CS Strukturální dialog o migraci mezi EU a Latinskou Amerikou DE Strukturierter Dialog über Migrationsfragen zwischen der EU und den Ländern Lateinamerikas und der Karibik EL Διαρθρωµένος Διάλογος για τη Μετανάστευση ΕΕ- ΛΑΚ (χώρες της Λατινικής Αµερικής και της Καραϊβικής) A forum for the identification of common challenges and areas for mutual cooperation, as well as building a stronger evidence base for EU-LAC (Latin America and the Caribbean) migration in order to better understand its realities, based on the principle of shared responsibility, strengthening the commitment and willingness of both sides to discuss migration issues. E Source(s) H EN EU-LAC Structured Dialogue on Migration Description of the EU-LAC Structured Dialogue on Migration on the IOM-Website ES Diálogo estructurado UE-ALC sobre migración Synonym(s) F G I EU-CELAC MD European Union - Latin America and the Carribbean structured and comprehensive bi-regional Dialogue on Migration (EU-CELAC MD) J FR Dialogue structuré sur les migrations entre l’UE et les pays d’Amérique latine et des Caraïbes (ALC) Related term(s) L GA Idirphlé Struchtúrtha idir an AE agus tíortha Mheiriceá Laidinigh agus Mhuir Chairib (MLC) maidir leis an Imirce EMN Asylum and Migration Classification M Euro Voc Classification N ET (EL ja Lõuna-Ameerika ning Kariibi) või EL ja LAC rände struktureeritud dialoog FI EU:n ja Latinalaisen Amerikan ja Karibian maiden välinen rakenteellinen vuoropuhelu muuttoliikkeestä HR Strukturirani dijalog o migracijama između EU-a - LAK-a Global Approach to Migration and Mobility (GAMM) 15.1 EU External dimension of migration and mobility 10 European Union HU EU-LAC strukturális migrációs párbeszéd O Note(s) IT Dialogo strutturato UE-ALC sulla migrazione LT ES-Lotynų Amerikos ir Karibų jūros regiono valstybių struktūrinis dialogas migracijos klausimais LV Eiropas Savienības, Latīņamerikas un Karību jūras reģiona valstu strukturēts dialogs par migrāciju MT Djalogu Strutturat fuq il-Migrazzjoni - UE u ALK NL EU-LAC gestructureerde dialoog over migratie PL EU-LAC Strukturalny dialog na rzecz migracji PT diálogo estruturado sobre migrações EU-ALC RO Dialogul structurat cu privire la migraţie EU-LAC / Dialogul structurat UE-ALC privind migrația 1. In June 2009, the European Union and the countries of Latin America and the Caribbean (LAC) formally launched the Structured and Comprehensive bi-regional Dialogue on Migration. 2. In the framework of the Dialogue, parties will exchange views in the following main areas: link between migration and development; regular migration and irregular migration; migration and the issue of human rights, including protection of migrants in accordance with international obligations; the fight against all forms of discrimination, racism and xenophobia; legislative and administrative measures applicable to migrants in an irregular situation; issues related to return on a dignified basis and voluntary return; measures to combat trafficking in human beings and smuggling of migrants, and the prevention of document fraud. 3. For more information, see the desciption of the EU-LAC Dialogue on the EEAS webpage. P Q R S T U SK Štruktúrovaný dialóg EÚ - Latinská Amerika a Karibik o migrácii V SL Strukturirani dialog o migracijah med EU in LAK SV EU-LAC:s strukturerade dialog om migration W NO EU–LACs strukturerte dialog om migrasjon KA ევროკავშირ-ლათინური ამერიკისა და კარიბის X ზღვის აუზის ქვეყნების (EU-LAC) სტრუქტურირებული დიალოგი მიგრაციის თაობაზე Y UK Структурований діалог з міграції між ЄС і країнами Латинської Америки та Карибського басейну (ЛАКБ) HY K Z ԵՄ-ԼԱԵ-ի (Լատինական Ամերիկայի և Կարիբյան երկրների) միջեւ §կառուցվածքային երկխոսություն միգրացիայի մասին EMN ASYLUM AND MIGRATION GLOSSARY 10.0 195
Eurasil BG Евроазил CS Eurasil Definition(s) ES Eurasil A European Union Network for asylum practitioners providing a forum for the exchange of country of origin information (COI), best practices and a variety of policy-related matters among EU Member States, asylum adjudicators and the European Commission, which aims to improve and maximise convergence on approaches to, and assessment of, the protection needs of asylum seekers. ET Eurasil Source(s) DE Netzwerk für Asylpraktiker der Europäischen Union / Eurasil EL το δίκτυο EURASIL της ΕΕ για τους ασχολούμενους με το άσυλο EN Eurasil FI Eurasil FR Eurasil GA Eurasil HR Eurasil HU Eurasil European Commission Staff Working Document SEC(2006) 189 - Annex C to the Communication from the Commission on strengthened practical cooperation COM(2006) 67 final Related term(s) LT Eurasil Common European Asylum System (CEAS) country of origin information (COI) European Asylum Support Office (EASO) LV Eurasil EMN Asylum and Migration Classification IT Eurasil MT Eurasil 6.3 Specific aspects of migration procedures NL Eurasil Euro Voc Classification PL Eurasil PT Eurasil RO Eurasil SK Eurasil SL Eurasil SV Eurasil NO Eurasil KA ევრასილი (Eurasil) UK Eurasil HY 196 ԵՄ-ի EURASIL ցանցը ապաստանի հարցերով զբաղվող մասնագետների համար 10 European Union| 2811 migration Note(s) 1. Eurasil was established by the European Commission in July 2002 following the decision of the Committee of the Permanent Representatives (Coreper II) on 6 March to cease the activities of the CIREA group (Centre for Information, Discussion and Exchange on the Crossing of Frontiers and Immigration (CIREFI). 2. EURASIL meetings were attended by representatives of the national ministries and asylum authorities of the EU Member States, as well as of CH, NO and IS. Depending on the topics of the meeting, international organisations such as United Nations High Commissior for Refugees (UNHCR) or International Organization for Migration (IOM) attended Eurasil as external experts. 3. With the establishment of the European Asylum Support Office (EASO), EASO has taken over responsibility for Eurasil and further developed EURASIL activities (EASO Practical Cooperation). EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B Eurodac C BG Евродак D Definition(s) CS Eurodac FR Eurodac The name given to an informatic system, the purpose of which, via the collection, transmission and comparison of fingerprints, is to assist in determining which EU Member State is to be responsible pursuant to Regulation (EU) No 604/2013 (Dublin III Regulation) for the examination of an application for international protection lodged in a EU Member State by a third-country national or a stateless person, and otherwise to facilitate the application of Regulation (EU) No 604/2013 under the conditions set out in the Regulation establishing Eurodac. GA Eurodac Source(s) DE Eurodac EL Ευrodac EN Eurodac ES Eurodac ET Eurodac FI Eurodac Art. 1 of Regulation (EU) No 603/2013 (Eurodac Regulation) HR Eurodac HU Eurodac LV Eurodac NL Eurodac PL Eurodac PT Eurodac RO Eurodac SK Eurodac SV Eurodac KA ევროდაკი (Eurodac) UK Eurodac HY M Euro Voc Classification O ԵՄ ապաստանի մատնահետքերի տվյալների բազա N P Note(s) NO Eurodac I 6.2.2 Dublin Procedure| 6.3.2. Establishment of identity of applicants for international protection (incl. examination of documents, language analysis, age assessment)| 14.4 Technological factor and impacts (digitalization of processes v paper processes) 1011 European Union law SL Eurodac H L EMN Asylum and Migration Classification MT Eurodac (Il-) G K Dublin Convention Dublin Regulation LT Eurodac F J Related term(s) IT Eurodac E Under the Eurodac system, participating States have to promptly take the fingerprints of each applicant for international protection over the age of 14. These fingerprints are then compared with fingerprint data transmitted by other participating States stored in the central database AFIS. If Eurodac shows that the fingerprints have already been recorded, the applicant can be sent back to the country where their fingerprints were originally taken. Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 197
Euro-Mediterranean Partnership (EUROMED) BG Евро-средиземноморско партньорство CS Evropsko-středomořské partnerství DE Europa-Mittelmeer-Partnerschaft / Euro‑mediterrane Partnerschaft EL Ευρωμεσογειακή Εταιρική Σχέση EN Euro-Mediterranean Partnership (EUROMED) ES Asociación Euromediterránea Definition(s) A Union of the EU Member States and 16 Southern Mediterranean countries built on cooperation agreements that aims to promote economic integration and democratic reform across the EU’s neighbours to the south in North Africa and the Middle East. Source(s) FR Partenariat euro-méditerranéen (EUROMED) European Commission: Communication on the Barcelona Process: Union for the Mediterranean.- COM(2008) 319 final and Website of the Southern Neighbourhood GA an Chomhpháirtíocht Eora-Mheánmhara Synonym(s) ET Euroopa-Vahemere partnerlus FI Euro–Välimeri-kumppanuus HR Euro-mediteransko partnerstvo (EUROMED) HU Euro-mediterrán Partnerség IT Partenariato euromediterraneo LT Europos-Viduržemio jūros regiono partnerystė LV Eiropas un Vidusjūras reģiona valstu partnerība MT Sħubija Ewro-Mediterranja NL Euro-mediterraan partnerschap PL Partnerstwo Eurośródziemnomorskie PT Parceria Euro-Mediterrânica RO Parteneriatul Euro-Mediteraneean SK Euro-stredomorské partnerstvo (EUROMED) SL Evro-sredozemsko partnerstvo SV Europa-Medelhavspartnerskapet NO Euro-Mediterranean Partnership KA ევროკავშირ-ხმელთაშუაზღვისპირეთის პარტნიორობა (EUROMED) UK Євро-Середземноморське партнерство (EUROMED) HY 198 Եվրո-միջերկրածովյան գործընկերություն Barcelona Process EUROMED UfM Union for the Mediterranean Broader term(s) European Neighbourhood Policy (ENP) Related term(s) Black Sea Synergy Eastern Partnership (EAP) EMN Asylum and Migration Classification 15.1 EU External dimension of migration and mobility Euro Voc Classification 10 European Union Note(s) 1.The Barcelona Process was launched in 1995 with the aim of strengthening the relations between the Eruopean Union and the Southern Mediterranean countries. 2. The cooperation led later to the creation of the Union for the Mediterranean (UfM). For more information, see the webpage of Union for Mediterranean (UfM) “25 years of the Barcelona Process 1995 -2005’. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B European Agenda on Migration BG европейска програма за миграцията C D Definition(s) CS Evropský program pro migraci E ES Agenda Europea de Migración A strategic document of the European Union presented in May 2015 outlining a comprehensive approach to migration management addressing the asylum and migration challenges as well as defining steps to be taken to ensure strong borders, fair procedures and a sustainable system able to anticipate future problems in the context of asylum and migration. ET Euroopa rändekava Source(s) H DE Europäische Migrationsagenda / Europäische Agenda für Migration EL Ευρωπαϊκή ατζέντα για τη μετανάστευση EN European Agenda on Migration FI Euroopan muuttoliikeagenda FR agenda européen en matière de migration GA Clár Oibre Eorpach maidir leis an Imirce HR Europski migracijski program HU Európai Migrációs Stratégia IT Agenda europea sulla migrazione LT Europos migracijos darbotvarkė LV Eiropas programma migrācijas jomā MT Aġenda (L-) Ewropea dwar il-Migrazzjoni NL Europese migratieagenda PL Europejska Agenda na Rzecz Migracji PT Agenda Europeia da Migração RO Agenda europeană privind migrația SK Európska migračná agenda SL Evropska agenda o migracijah SV den europeiska migrationsagendan NO Europeisk migrasjonsagenda KA მიგრაციის ევროპული დღის წესრიგი UK Європейський порядок денний з питань міграції HY Միգրացիայի եվրոպական օրակարգ European Commission: Communication: A European Agenda on Migration, COM(2015) 240 final F G I Related term(s) J Partnership Framework on Migration EMN Asylum and Migration Classification 2.2 EU (e.g. Common European Asylum System, Qualification Directive, European Agenda for Migration) K Euro Voc Classification L 1011 European Union law M Note(s) 1. The European Agenda on Migration was presented by the European Commission on 13 May 2015. 2. It defines short term and long term priorities focusing on the following four pillars: ƒ a Common European Asylum System (CEAS); ƒ a new European policy on legal migration; ƒ fighting irregular migration and trafficking in human beings more robustly; ƒ and securing the external EU borders. 3. The Partnership Framework on Migration with third countries under the European Agenda on Migration was launched in June 2016, (see European Commission: Communication on establishing a new Partnership Framework with third countries under the European Agenda on Migration, COM(2016) 385 final). It fully integrates migration in the European Union’s foreign policy and is the EU’s comprehensive cooperation approach to better manage migration flows. Tailor-made agreements (compacts) with key third countries of origin and transit were developed with the following short-term objectives: ƒ to save lives in the Mediterranean sea; ƒ to increase the rate of returns to countries of origin and transit; and ƒ to keep migrants and refugees close to home. 4. In the long term, the EU should continue to increase its efforts to address the root causes of irregular migration and forced displacement and to provide capacity building to the host communities and relevant institutions. N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 199
European Asylum Support Office (EASO) BG Европейска служба за подкрепа в областта на убежището CS Evropský podpůrný úřad pro otázky azylu DE Europäisches Unterstützungsbüro für Asylfragen EL Ευρωπαϊκό Γραφείο Υποστήριξης για το Άσυλο EN European Asylum Support Office (EASO) ES Oficina Europea de Apoyo al Asilo ET Euroopa Varjupaigaküsimuste Tugiamet FI Euroopan turvapaikka-asioiden tukivirasto FR Bureau européen d’appui en matière d’asile GA an Oifig Tacaíochta Eorpach do Chúrsaí Tearmainn HR Europski potporni ured za azil (EASO) HU Európai Menekültügyi Támogatási Hivatal IT Ufficio Europeo di Sostegno per l’Asilo LT Europos prieglobsčio paramos biuras LV Eiropas Patvēruma atbalsta birojs MT Uffiċċju (L-) Ewropew t’ Appoġġ għall‑Ażil (UEAA / EASO) Definition(s) A European Union agency mandated to focus on three major responsibilities: to contribute to the coherent implementation and development of the Common European Asylum System (CEAS), to support and strengthen practical cooperation among EU Member States on asylum and to provide and / or coordinate the provision of operational support to EU Member States, subject to particular pressure on their asylum and reception systems. Source(s) Derived by EMN from Art. 1 and 2 of Regulation (EU) No 439/2010 (EASO Regulation) Synonym(s) EASO European Asylum Support Office Broader term(s) international protection Related term(s) RO Biroul European de Sprijin în domeniul Azilului Common European Asylum System (CEAS) Eurasil European Border and Coast Guard Agency (Frontex) European Migration Network (EMN) European Union Agency for Asylum (EUAA) European Union Agency for Fundamental Rights (FRA) General Directors’ Immigration Services Conference (GDISC) SK Európsky podporný úrad pre azyl (EASO) EMN Asylum and Migration Classification NL Europees Ondersteuningsbureau voor Asielzaken; Europees asielondersteuningsbureau (BE) PL Europejski Urząd Wsparcia w dziedzinie Azylu PT Gabinete Europeu de Apoio ao Asilo SL Evropski azilni podporni urad SV Europeiska byrån för samarbete i asylfrågor NO Det europeiske støttekontoret på asylfeltet KA ევროპის თავშესაფრის მხარდაჭერის ოფისი (EASO) UK Європейське бюро з питань надання притулку (EASO) HY 200 Ապաստանի աջակցության եվրոպական գրասենյակ 2.2 EU (e.g. Common European Asylum System, Qualification Directive, European Agenda for Migration)| 4.1 International protection Euro Voc Classification 1006 EU institutions and European civil service| 2811 migration Note(s) 1. The European Asylum Support Office acts as a European centre of expertise on asylum, responsible for facilitating, coordinating and strengthening practical cooperation among EU Member States on the many aspects of asylum, so that EU Member States are better able to provide international protection to those entitled to it, while dealing fairly and efficiently with those who do not qualify for international protection, where appropriate. 2. The Support Office should work closely with the EU Member States’ asylum authorities, with national immigration and asylum services and other national services and with the European Commission. Furthermore, it should also carry out its duties without prejudice to those assigned to other relevant bodies of the European Union and shall work closely with these bodies as well as with the United Nations High Commissioner for Refugees (UNHCR). However, it does not have any powers in relation to the taking of decisions by EU Member States’ asylum authorities on individual applications for international protection. 3. On 19 January 2022 Regulation (EU) 2021/2303 on the establishment of a European Union Agency for Asylum (EUAA Regulation) entered into force, transforming the European Asylum Support Office (EASO) into a full-fledged agency with a broadened and enhanced mandate. For more information see the entry of the European Union Agency for Asylum (EUAA) in this glossary. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B European Border and Coast Guard BG Европейския парламент и на Съвета и за отмяна на Регламент CS Evropská pohraniční a pobřežní stráž DE Europäische Grenz- und Küstenwache EL Ευρωπαϊκή Συνοριοφυλακή και Ακτοφυλακή EN European Border and Coast Guard C D Definition(s) A border control and management system covering the Schengen Area which is composed of the European Border and Coast Guard Agency (a reformed Frontex Agency) and EU Member State national authorities who are responsible for border management tasks. Source(s) ES Guardia Europea de Fronteras y Costas ET Euroopa piiri- ja rannikuvalve Art. 3 and 5 of Regulation (EU) 2019/1896 (European Border and Coast Guard Regulation) FI Eurooppalainen raja- ja merivartiosto Broader term(s) FR Corps européen de garde-frontières et de gardecôtes J European Border and Coast Guard Agency (Frontex) HU Európai Határ- és Parti Őrség K Related term(s) IT Guardia Costiera e di Frontiera Europea G I Narrower term(s) HR Europska granična i obalna straža F H border control external EU border GA Garda Teorann agus Cósta Eorpach E LT Europos sienų ir pakrančių apsaugos pajėgos European Border Surveillance System (EUROSUR) European integrated border management L LV Eiropas Robežu un krasta apsardze EMN Asylum and Migration Classification M Euro Voc Classification N MT Gwardja Ewropea tal-Fruntieri u l-Kosti 6.1 Entry Conditions and Procedures NL Europese Grens- en Kustwacht PL Europejska Straż Graniczna i Przybrzeżna 1006 EU institutions and European civil service O PT Guarda Europeia de Fronteiras e Costeira RO Poliția de frontieră și garda de coastă la nivel european P SK Európska pohraničná a pobrežná stráž Q SL Evropska mejna in obalna straža SV Europeiska gräns- och kustbevakningen NO Den europeiske grense-og kystvakten (b); Den europeiske grense- og kystvakta R KA ევროპის სასაზღვრო და სანაპირო დაცვა S UK Європейська служба з охорони зовнішніх кордонів HY T Եվրոպական սահմանային և առափնյա պաշտպանություն U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 201
European Border and Coast Guard Agency (Frontex) BG Европейска агенция за граничен контрол и брегова охрана CS Evropská agentura pro pohraniční a pobřežní stráž DE Europäische Agentur für die Grenz- und Küstenwache EL Ευρωπαϊκός Οργανισμός Συνοριοφυλακής και Ακτοφυλακής EN European Border and Coast Guard Agency (Frontex) ES Guardia Europea de Fronteras y Costas ET Euroopa Piiri- ja Rannikuvalve Amet FI Euroopan raja- ja merivartiovirasto (Frontex) FR Agence européenne de garde-frontières et de garde-côtes GA an Gníomhaireacht Eorpach um an nGarda Teorann agus Cósta HR Europska agencija za graničnu i obalnu stražu (FRONTEX) HU Európai Határ- és Partvédelmi Ügynökség IT Agenzia europea della guardia di frontiera e costiera LT Europos sienų ir pakrančių apsaugos agentūra Definition(s) A European Union agency tasked with the implementation of the European integrated border management, the effective functioning of border control at the external EU borders in coordination with the national authorities of EU Member States and Schengen associated countries (IC, CH, LI and NO) responsible for border management, the internal security within the European Union and migration management, including an effective return policy, while safeguarding the free movement of persons within the Union and full respect for fundamental rights. Source(s) Art. 1 and 7 of Regulation (EU) 2019/1896 (Europe-an Border and Coast Guard Regulation) Synonym(s) EBCGA European Agency for the Management of Operational Cooperation at the External Borders of the Member States of the European Union Frontex LV Eiropas Robežu un krasta apsardzes aģentūra (Frontex) Broader term(s) MT Aġenzija (L-) Ewropea għall-Ħarsien / Gwardja tal-Fruntieri u l-Kosti (Frontex) Narrower term(s) NL Europees Grens- en Kustwachtagentschap PL Europejska Agencja Straży Granicznej i Przybrzeżnej PT Agência Europeia da Guarda de Fronteiras e Costeira RO Agenția Europeană pentru Poliția de Frontieră și Garda de Coastă SK Európska agentúra pre pohraničnú a pobrežnú stráž (Frontex) SL Evropska agencija za mejno in obalno stražo European Border and Coast Guard European Border and Coast Guard Standing Corps Related term(s) European integrated border management European Union Agency for Asylum (EUAA) European Union Agency for Fundamental Rights (FRA) High-Level Network for Return Return Coordinator EMN Asylum and Migration Classification NO Den europeiske grense- og kystvakt 2.2 EU (e.g. Common European Asylum System, Qualification Directive, European Agenda for Migration)| 6.1 Entry Conditions and Procedures KA ევროპის სასაზღვრო და სანაპირო დაცვის Euro Voc Classification SV Europeiska gräns- och kustbevakningsbyrån სააგენტო (Frontex) UK Європейське агентство з охорони зовнішніх кордонів (Frontex) HY 202 1006 EU institutions and European civil service Եվրոպական սահմանային և առափնյա պահպանության գործակալություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. The European Agency for the Border and Coast Guard based in Warsaw was established by Regulation (EU) No 2016/1624 (European Border and Coast Guard Regulation) of 14 September 2016. It is not a new body but emerged from the European Agency for the Management of Operational Cooperation at the External Borders of the EU Member States which was established in 2004 by Council Regulation (EC) 2007/2004 (Frontex-Regulation). Its mandate and tasks have, however, been extended and it has been transformed into a fully-fledged European Agency. In order to reflect these changes, it was renamed the European Border and Coast Guard Agency which continues to be commonly referred to as ‘Frontex’. 2. In 2019, Regulation (EU) 2019/1896 provided the European Border and Coast Guard with a reinforced mandate and increased competencies, such as the European Border and Coast Guard Standing Corps, which is the EU’s first uniformed service. The corps includes 10 000 border and coast guard officers and equipment. This is a major difference compared to the previous Regulation which did not enable the Agency to have its own equipment and personnel. The standing corps consists of Frontex and EU Member State officers and work under the command of the national authorities of the country they are deployed in. In addition, Frontex will develop and strengthen EU’s border management capacities and become more active outside the EU by conducting operations in non-EU countries outside external EU borders. 3. Art.10 of Regulation (EU) No 2019/1896 describes the main tasks of the Agency which include among others: ƒ monitoring migration flows and carrying out risk analysis as regards all aspects of integrated border management; ƒ supporting migration management support teams at hotspot areas by deploying operational staff and technical equipment to provide assistance in screening, de-briefing, identification and fingerprinting of migrants; ƒ coordinating and organising joint operations and rapid border interventions to assist participating states at the external EU borders, including humanitarian emergencies and rescue at sea; ƒ setting up and deploying European Border and Coast Guard teams, including a rapid reaction pool; ƒ supporting the development and operation of the European Border Surveillance System (EUROSUR) as well as setting up and running of the Central unit of the European Travel Information and Authorisation System (ETIAS); ƒ assisting participating states in fulfilling their return including coordinating and organising return operations. 4. Another objective of the Agency is the prevention of cross-border crime such as smuggling of migrants, terrorism or trafficking in human beings. 5. Frontex cooperates with various European agencies and institutions within their respective mandates, such as Europol, Eurojust, European Union Agency for Asylum (EUAA), European Union Agency for Fundamental Rights (FRA), European Fisheries Control Agency (EFCA) and the European Maritime Safety Agency (EMSA) as well as with third countries in relation to the areas covered by the regulation. 6. For further information, see the website of Frontex. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 203
European Border and Coast Guard Standing Corps BG Постоянен корпус на европейската гранична и брегова охрана CS stálý útvar Evropské pohraniční a pobřežní stráže DE Ständige Reserve der Europäischen Grenz- und Küstenwache EL μόνιμο σώμα της Ευρωπαϊκής Συνοριοφυλακής και Ακτοφυλακής EN European Border and Coast Guard Standing Corps ES cuerpo permanente de la Guardia Europea de Fronteras y Costas ET Euroopa piiri- ja rannikuvalve alaline korpus FI eurooppalaisen raja- ja merivartioston pysyvä joukko FR Contingent permanent du corps de garde-frontières et de garde-côtes européens Definition(s) Pool of border and coast guards on short-term deployment or long-term secondment from EU Member States to the European Border and Coast Guard Agency (Frontex) to be deployed as members of the border management teams, migration management support teams and return teams in joint return operations, rapid border interventions, return interventions or any other relevant operational activities in the EU Member States or in third countries. Source(s) Derived by EMN from Art. 54 of Regulation (EU) 2019/1896 (European Border and Coast Guard Regulation) Broader term(s) European Border and Coast Guard Agency (Frontex) GA HR stalne snage Europske granične i obalne straže HU az Európai Határ- és Parti Őrség készenléti alakulata IT corpo permanente della guardia di frontiera e costiera europea LT Europos sienų ir pakrančių apsaugos nuolatinis korpusas LV Eiropas Robežu un krasta apsardzes pastāvīgais korpuss MT korp permanenti tal-Gwardja Ewropea tal-Fruntiera u tal-Kosta / Korp (il-) Regolari Ewropew għall-Ħarsien tal-Fruntieri u l-Kosti / NL permanent korps van de Europese grens- en kustwacht PL stała służba Europejskiej Straży Granicznej i Przybrzeżnej PT Corpo Permanente da Guarda Europeia de Fronteiras e Costeira RO corpul permanent al poliției de frontieră și gărzii de coastă la nivel european SK Stály zbor Európskej pohraničnej a pobrežnej stráže Related term(s) migration management support team return intervention return operation EMN Asylum and Migration Classification 2.2 EU (e.g. Common European Asylum System, Qualification Directive, European Agenda for Migration)| 6.1.1 Border control Euro Voc Classification 1006 EU institutions and European civil service| 2811 migration Note(s) 1. The European Border and Coast Guard Standing Corps is the European Union’s uniformed service which was established by Regulation (EU) 2019/1896 (European Border and Coast Guard Regulation) in 2019. Frontex border and coast guards ensure the proper functioning of the EU’s Schengen Area. This includes support in migration management, fighting cross-border crime and return activities, as well as supporting national authorities in making the crossing of the border safe and smooth for all travellers. 2. Frontex border guards work under the command of the national authorities of the country they are deployed in. SL stalna enota evropske mejne in obalne straže SV europeiska gräns- och kustbevakningens stående styrka NO Den europeiske grense- og kystvaktens stående korps KA ევროპის სასაზღვრო და სანაპირო დაცვის მუდმივი კორპუსი UK Постійний корпус Європейської прикордонної та берегової охорони HY 204 Եվրոպական սահմանային և առափնյա պաշտպանության մշտական մարմին EMN ASYLUM AND MIGRATION GLOSSARY 10.0
European Border Surveillance System (EUROSUR) BG Европейска система за наблюдение на външните граници CS Evropský systém ostrahy vnější hranice DE Europäisches Grenzüberwachungssystem EL Ευρωπαϊκό Σύστημα Επιτήρησης των Συνόρων EN European Border Surveillance System (EUROSUR) ES Sistema europeo de vigilancia de fronteras ET Euroopa piiride valvamise süsteem FR Système européen de surveillance des frontières GA an Córas Eorpach um Fhaireachas ar Theorainneacha Seachtracha HU európai határőrizeti rendszer B C D Definition(s) A common framework for the exchange of information and for the cooperation between EU Member States and Frontex to improve situational awareness and to increase reaction capability at the external EU borders for the purpose of detecting, preventing and combating irregular migration and cross-border crime, and contributing to ensuring the protection and saving the lives of migrants. Source(s) FI Euroopan rajavalvontajärjestelmä HR Europski sustav nadzora granica A E F G H Art. 2(9) and Sec. 3 of Regulation (EU) 2019/1896 (European Border and Coast Guard Regulation) I Synonym(s) J Related term(s) K EUROSUR IT Sistema europeo di sorveglianza delle frontiere esterne border control European Border and Coast Guard Agency (Frontex) LT Europos išorinių sienų stebėjimo sistema EMN Asylum and Migration Classification L M LV Eiropas ārējo robežu uzraudzības sistēma 6.1.1 Border control| 13. Irregular Migration MT Sistema Ewropea għas-Sorveljanza tal-Konfini / tal-Fruntieri 2811 migration N Note(s) O NL Europees grensbewakingssysteem PL Europejski system nadzorowania granic PT Sistema Europeu de Vigilância das Fronteiras RO sistemul de supraveghere a frontierelor UE SK Európsky systém hraničného dozoru (EUROSUR) Euro Voc Classification 1. EUROSUR was set up under Council Regulation (EU) No 1052/2013 (EUROSUR Regulation) . 2. For more information, see the webpage of the European Commission on EUROSUR. Q SL Evropski sistem varovanja meja R SV europeiska gränsövervakningssystemet NO Det europeiske overvåkingssystemet for yttergrensene S KA ევროპის სასაზღვრო მეთვალყურეობის სისტემა (EUROSUR) T UK Європейська система прикордонного нагляду (EUROSUR) HY P U Սահմանի հսկողության եվրոպական համակարգ V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 205
European Convention on Human Rights (ECHR) BG Европейска конвенция за правата на човека CS Evropská úmluva o ochraně lidských práv DE Europäische Menschenrechtskonvention (EMRK) EL Ευρωπαϊκή Σύμβαση Δικαιωμάτων του Ανθρώπου EN European Convention on Human Rights (ECHR) ES Convenio Europeo de Derechos Humanos ET Euroopa inimõiguste ja põhivabaduste kaitse konvetsioon FI Euroopan ihmisoikeussopimus Definition(s) A regional human rights instrument giving effect to certain rights stated in the Universal Declaration of Human Rights, offering individuals the possibility of applying to the courts for the enforcement of their rights. Source(s) Derived by EMN from the description of the Convention on the website of the European Court of Human Rights Synonym(s) GA an Coinbhinsiún Eorpach um Chearta an Duine European Convention for the Protection of Human Rights and Fundamental Freedoms ECHR HR Europska konvencija o ljudskim pravima (EKLJP) Related term(s) FR Convention européenne des droits de l’homme HU Emberi Jogok Európai Egyezménye (EJEE) IT Convenzione Europea dei Diritti dell’Uomo LT Europos žmogaus teisių konvencija LV Eiropas Cilvēktiesību konvencija MT Konvenzjoni (Il-) Ewropea dwar id-Drittijiet tal‑Bniedem Charter of Fundamental Rights of the European Union European Union Agency for Fundamental Rights (FRA) human rights human rights law EMN Asylum and Migration Classification NL Europees Verdrag voor de Rechten van de Mens 2.3 Regional and Transnational (e.g. European Convention of Human Rights) PL Europejska Konwencja Praw Człowieka / Konwencja o Ochronie Praw Człowieka i Podstawowych Wolności 1231 international law PT Convenção Europeia dos Direitos Humanos RO Convenţia Europeană a Drepturilor Omului (CEDO) SK Európsky dohovor o ochrane ľudských práv a základných slobôd (EDĽP) Euro Voc Classification Note(s) More formally referred to as the European Convention for the Protection of Human Rights and Fundamental Freedoms. SL Evropska konvencija o človekovih pravicah SV Europakonventionen om de mänskliga rättigheterna NO Den europeiske menneskerettskonvensjonen KA ადამიანის უფლებათა ევროპული კონვენცია (ECHR) UK Європейська конвенція з прав людини (ЄКПЛ) HY 206 Մարդու իրավունքների եվրոպական կոնվենցիա EMN ASYLUM AND MIGRATION GLOSSARY 10.0
European Court of Human Rights (ECtHR) BG Европейски съд за правата на човека A B C D Definition(s) CS Evropský soud pro lidská práva E EL Ευρωπαϊκό Δικαστήριο των Δικαιωμάτων του Ανθρώπου International court established by the European Convention on Human Rights (ECHR) which rules on individual or State applications alleging violations of the civil and political rights set out in the ECHR. EN European Court of Human Rights Source(s) G Synonym(s) H Broader term(s) I DE Europäischer Gerichtshof für Menschenrechte (EGMR) Website of the European Court of Human Rights ES Tribunal Europeo de Derechos humanos ET Euroopa Inimõiguste Kohus ECtHR FI Euroopan ihmisoikeustuomioistuin FR Cour européenne des droits de l’homme human rights human rights law GA an Chúirt Eorpach um Chearta an Duine HR Europski sud za ljudska prava (ESLJP) J Related term(s) HU Emberi Jogok Európai Bírósága (EJEB) K Court of Justice of the European Union (CJEU) IT Corte europea dei diritti dell’uomo EMN Asylum and Migration Classification LT Europos Žmogaus Teisių Teismas F LV Eiropas Cilvēktiesību tiesa 2.3 Regional and Transnational (e.g. European Convention of Human Rights) L MT Qorti (Il-) Ewropea tad-Drittijiet tal-Bniedem Euro Voc Classification M NL Europees Hof voor de Rechten van de Mens (EHRM) 1231 international law N PL Europejski Trybunał Praw Człowieka Note(s) PT Tribunal Europeu dos Direitos Humanos RO Curtea Europeană a Drepturilor Omului (CEDO) SK Európsky súd pre ľudské práva (ESĽP) SL Evropsko sodišče za človekove pravice SV Europeiska domstolen för de mänskliga rättigheterna / Europadomstolen NO Den europeiske menneskrettsdomstolen KA ადამიანის უფლებათა ევროპული სასამართლო 1. The ECtHR was set up in 1959, it is based in Strasbourg. 2. It hears applications alleging that a contracting state has breached one or more of the human rights provisions concerning civil and political rights set out in the European Convention on Human Rights (ECHR) and its protocols. An application can be lodged by an individual, a group of individuals or one or more of the other contracting states, and, besides judgments, the Court can also issue advisory opinions. 3. The judgments of the court are binding on the countries concerned and have led governments to alter their legislation and administrative practice in a wide range of areas. (ECtHR) P Q R S UK Європейський суд з прав людини (ЄСПЛ) HY O Մարդու իրավունքների եվրոպական դատարան T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 207
European Guardianship Network (EGN) BG Европейска мрежа на институциите за настойничество и попечителство Definition(s) DE Europäisches Netzwerk für Vormundschaft; Europäisches Netzwerk für Obsorge (AT) Network that aims to improve services for unaccompanied or separated children in the EU Member States through guardianship development and assistance to practitioners and their organizations. EL Ευρωπαϊκό Δίκτυο Επιτροπείας (EGN) Source(s) CS Evropská síť opatrovníků EN European Guardianship Network (EGN) Website of the EGN ES Red Europea de Tutela Synonym(s) FI Euroopan huoltajuusverkosto EGN European Guardianship Network FR Réseau européen de tutelle Related term(s) ET Euroopa eestkostevõrgustik GA Líonra Eorpach na Caomhnóireachta (LEC) HR Europska mreža skrbnika HU Európai Gyámügyi Hálózat IT Rete Europea della Tutela LT Europos globos institucijų tinklas LV Eiropas Aizbildnības tīkls MT Netwerk (In-) Ewropew tat-Tutela (NET) NL Europees netwerk inzake voogdij (EGN) PL Europejska Sieć Opieki PT Rede europeia de instituições de tutela (EGN) RO Rețeaua europeană de tutelă SK Európska sieť pre poručníctvo (EGN) SL Evropska mreža za skrbništvo SV European Guardianship Network NO Det europeiske vergemålsnettverket (b); Det europeiske verjemålsnettverket (N) guardian unaccompanied minor separated child EMN Asylum and Migration Classification 7.2 Minors and unaccompanied minors Euro Voc Classification 2806 family| 2811 migration Note(s) 1. First steps towards a European Guardianship Network were taken in 2005. Since then several projects on guardianship have been completed, financed by the European Commission under the European Programme for Integration and Migration and the Rights, Equality and Citizenship Programme. At the beginning of 2019 the network was transformed to a more formal, member-based structure, based on developments in the EU and in several EU Member States towards more professionalism in guardianship. 2. The network will enable further professionalization of guardianship systems, thus further improving the outcome for the children in the system. KA მეურვეთა ევროპული ქსელი (EGN) UK Європейська мережа з питань опіки та піклування (ЄМОП) HY 208 Եվրոպական խնամակալության ցանց EMN ASYLUM AND MIGRATION GLOSSARY 10.0
European integrated border management BG Европейска система за интегрирано управление на границите DE integrierte europäische Grenzverwaltung EL Ευρωπαϊκή ολοκληρωμένη διαχείριση των συνόρων ES Gestión Europea integrada de las fronteras ET Euroopa integreeritud piirihaldus B C D Definition(s) CS Evropská integrovaná správa hranic EN European integrated border management A National and international coordination and cooperation among all relevant authorities and agencies involved in border security and trade facilitation to establish effective, efficient and coordinated border management at the external EU borders, in order to reach the objective of open, but well controlled and secure borders. Source(s) E F G H FI Euroopan yhdennetty rajavalvonta Art. 3 of Regulation (EU) 2019/1896 (European Border and Coast Guard Regulation) FR gestion européenne intégrée des frontières Synonym(s) I GA Bainistiú comhtháite teorainneacha san Eoraip IBM HR Europsko integrirano upravljanje granicama Broader term(s) J IT Gestione europea integrata delle frontiere border control external EU border LT Europos integruotas sienų valdymas Narrower term(s) HU európai integrált határigazgatás LV Eiropas integrētā robežu pārvaldība MT Ġestjoni Ewropea integrata tal-fruntieri NL Europees geïntegreerd grensbeheer PL Europejski zintegrowany system zarządzania granicami PT Gestão europeia integrada de Fronteiras RO Gestionarea europeană integrată a frontierelor SK Európske integrované riadenie hraníc SL evropsko integrirano upravljanje meja SV Europeisk integrerad gränsförvaltning NO Samordnet europeisk grense grensekontroll (b); Samordna europeisk grensekontroll (n) KA ევროპის საზღვრის ინტეგრირებული მართვა UK Європейське інтегроване управління кордонами HY Եվրոպական ինտեգրված սահմանների կառավարում K L border control European Border and Coast Guard Agency (Frontex) search and rescue (SAR) operation M Related term(s) European Border and Coast Guard N EMN Asylum and Migration Classification O Euro Voc Classification P 6.1.1 Border control 0431 politics and public safety| 2811 migration Q Note(s) 1. The European integrated border management (IBM) aims at managing the crossing of the external borders efficiently and addressing migratory challenges and potential future threats at those borders, thereby contributing to addressing serious crime with a cross-border dimension (such as migrant smuggling, trafficking in human beings and terrorism) and ensuring a high level of internal security within the EU, while at the same time acting in full respect for fundamental rights and in a manner that safeguards the free movement of persons within the EU. 2. Art. 4 of the Regulation (EU) 2016/1624 (European Border and Coast Guard Regulation) describes the main components of the IBM: border control; prevention and detection of cross-border crime; referral of persons who are in need of, or wish to apply for, international protection; search and rescue operations for persons in distress at sea; risk analysis for internal security and security of the external EU borders; cooperation with third countries, focusing on neighbouring countries and those which have been identified as countries of origin and/or transit for irregular migration; return of third-country nationals who are subject of return decisions. R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 209
European Integration Network (EIN) BG Европейска мрежа за интеграция (ЕМИ) CS Evropská integrační síť (EIN) DE Europäisches Integrationsnetz (EIN) EL Ευρωπαϊκό Δίκτυο Ένταξης (ΕΔΕ/ΕΙΝ) EN European Integration Network (EIN) ES Red Europea de Integración ET Euroopa integratsioonivõrgustik FI Euroopan kotouttamisverkosto FR réseau européen d’Intégration GA HR Europska integracijska mreža HU Európai Integrációs Hálózat IT Rete europea sull’integrazione (EIN) LT Europos integracijos tinklas LV Eiropas integrācijas tīkls MT Netwerk (In-) Ewropew tal-Integrazzjoni (NEI) NL Europees Integratienetwerk PL Europejska Sieć Integracji PT Rede Europeia de Integração (REI) RO Rețeaua de integrare europeană Definition(s) Forum bringing together representatives of national public authorities from all EU Member States and IC and NO with the aim to promote cooperation on integration activities among EU Member States and to foster dialogue on integration with European, national, regional and local authorities, as well as civil society organisations. Source(s) Description of the European Integration Network on European Website on Integration. Synonym(s) EIN European Integration Network Broader term(s) integration Related term(s) European Migration Forum (EMF) EMN Asylum and Migration Classification 9.1 Integration measures Euro Voc Classification 2811 migration| 2826 social affairs SK Európska integračná sieť (EIN) SL Evropska mreža za vključevanje SV Europeiska integrationsnätverket NO European Integration Network (EIN) KA ინტეგრაციის ევროპული ქსელი (EIN) Note(s) 1. The EIN was established following the adoption of the 2016 Commission’s Action Plan on the integration of third-country nationals. 2. For more information see the Description of the European Integration Network on the European Website on Integration. UK Європейська інтеграційна мережа (ЄІМ) HY 210 Եվրոպական Ինտեգրման Ցանց (ԵՄՑ) EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B European Migration Forum (EMF) BG Европейски форум за миграцията (ЕФМ) CS Evropské migrační fórum (EMF) EL Ευρωπαϊκό Φόρουμ για τη Μετανάστευση (ΕΦΜ/EMF) ES Foro Europeo de Migración A platform for dialogue on integration issues and other topics on immigration and asylum between civil society organisations and European institutions which meet once a year for two days of work. E Source(s) G ET Euroopa rändefoorum Description of the European Migration Forum on the Website of DG Migration and Home Affairs. FI Euroopan muuttoliikefoorumi Synonym(s) FR Forum européen sur la migration (FEM) D Definition(s) DE Europäisches Migrationsforum (EMF) EN European Migration Forum (EMF) C F H GA Fóram Eorpach um Imirce EMF European Migration Forum I HR Europski migracijski forum Broader term(s) J HU Európai Migrációs Fórum (EMF) IT Forum europeo della migrazione integration Related term(s) LT Europos migracijos forumas European Integration Network (EIN) K LV Eiropas migrācijas forums EMN Asylum and Migration Classification MT Forum (Il-) Ewropew tal-Migrazzjoni (FEM) 9. Integration L NL Europees Migratieforum Euro Voc Classification M PL Europejskie Forum Migracji PT Fórum Europeu das Migrações (FEM) RO Forumul european privind migrația (FEM) SK Európske fórum pre migráciu (EMF) SL Evropski forum za migracije 2811 migration| 2826 social affairs N Note(s) The EMF was created in 2015 to replace the European Integration Forum, its extended scope now covers topics related to immigration and asylum, in addition to integration issues. SV Europeiskt migrationsforum NO European Migration Forum (EMF) P Q KA მიგრაციის ევროპული ფორუმი (EMF) R UK Європейський форум із питань міграції (EMF) HY O Եվրոպական միգրացիոն ֆորում S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 211
European migration liaison officer (EMLO) BG европейски служител за връзка по въпросите на миграцията CS Evropský styčný důstojník pro migraci DE Europäischer Verbindungsbeamter für Migrationsfragen EL Αξιωματικός σύνδεσμος μετανάστευσης της ΕΕ EN European migration liaison officer (EMLO) ES Funcionario de Enlace europeo para Migración ET Euroopa rändeküsimuste sideohvitser FI Euroopan muuttoliikeyhteyshenkilö FR officier de liaison «migration» européen GA oifigeach Eorpach idirchaidrimh imirce HR Europski časnik za vezu zadužen za migracije HU Európai migrációs összekötőtiszt IT Funzionario europeo di collegamento incaricato dell’immigrazione LT Europos migracijos ryšių palaikymo pareigūnas LV Eiropas migrācijas sadarbības koordinators MT Uffiċjal (L-) tal-kollegament Ewropew għallmigrazzjoni (UKEM) NL Europees migratieverbindingsfunctionaris PL Europejski oficer łącznikowy ds. migracji PT agente de ligação europeu da migração RO ofițer de legătură european în materie de migrație SK Európsky styčný dôstojník pre migráciu (EMLO) SL evropski uradnik za zvezo za migracije SV Europeisk sambandsman för migration NO Europeisk sambandsmann for migrasjon KA მიგრაციის საკითხებში ევროპის მეკავშირე Definition(s) A specialised liaison officer seconded in EU Delegations in third countries tasked to coordinate and represent EU interests in the field of migration with the aim of maximising the impact of EU action on migration in third countries and enhancing the engagement of key countries of origin and transit on the entire spectrum of migration. Source(s) Evaluation of Council Regulation (EC) No 377/2004 on the creation of an immigration liaison officers network: Final report - Study, 2018 Synonym(s) EMLO European migration liaison officer Related term(s) Immigration Liaison Officer (ILO) European return liaison officer (EURLO) Euro Voc Classification 1006 EU institutions and European civil service| 2811 migration Note(s) 1. EMLOs work in close cooperation with the immigration liaison officers’ (ILOs) network and with local authorities and civil society, with the purpose of inter alia gathering, exchanging and analysing information. 2. To avoid the duplication of tasks and ensure ILOs Network effectiveness, EMLOs are not supposed to interfere in national competences and interests of ILOs, but are supposed to coordinate and support the ILOs Network, facilitate the contacts between the ILOs by organising regular meetings and also support the ILOs in the contacts with third country authorities. 3. EMLOs primarily represent the interests of the EU as a whole vis-à-vis host country authorities and address EU information needs on irregular migration. ოფიცერი (EMLO) UK Європейський співробітник зі зв’язку з питань міграції (EMLO) HY 212 Երրորդ երկրներում ԵՄ պատվիրակություններում գործուղված միգրացիոն հարցերով պատասխանատու EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 213
European Migration Network (EMN) BG Европейска мрежа за миграция CS Evropská migrační síť DE Europäisches Migrationsnetzwerk EL Ευρωπαϊκό Δίκτυο Μετανάστευσης EN European Migration Network (EMN) ES Red Europea de Migración ET Euroopa rändevõrgustik FI Euroopan muuttoliikeverkosto FR Réseau européen des migrations (REM) GA Gréasán Imirce na hEorpa HR Europska migracijska mreža HU Európai Migrációs Hálózat (EMH) IT Rete Europea sulle Migrazioni LT Europos migracijos tinklas LV Eiropas migrācijas tīkls MT Netwerk (In-) Ewropew tal-Migrazzjoni (EMN) NL Europees Migratienetwerk PL Europejska Sieć Migracyjna PT Rede Europeia das Migrações RO Reţeaua europeană de migrație SK Európska migračná sieť (EMN) SL Evropska migracijska mreža SV Europeiska migrationsnätverket NO Det europeiske migrasjonsnettverket KA მიგრაციის ევროპული ქსელი (EMN) Definition(s) European Union body established by Council Decision 2008/381/EC that serves to meet the information needs of Union institutions and of EU Member States’ authorities and institutions, by providing up-to-date, objective, reliable and comparable information on migration and asylum, with a view to supporting policy-making in the European Union in these areas. Source(s) Art. 1 of Council Decision 2008/381/EC (European Migration Network Decision) Synonym(s) EMN European Migration Network Related term(s) Africa Caribbean Pacific (ACP) Observatory on Migration EU Immigration Portal European Border and Coast Guard Agency (Frontex) European Union Agency for Asylum (EUAA) European Union Agency for Fundamental Rights (FRA) Eurostat National Contact Points on Integration EMN Asylum and Migration Classification 2.2 EU (e.g. Common European Asylum System, Qualification Directive, European Agenda for Migration) Euro Voc Classification 1006 EU institutions and European civil service| 2811 migration UK Європейська міграційна мережа (ЄММ) HY 214 Եվրոպական Միգրացիոն Ցանց EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. The EMN was established in 2008 by the European Commission on behalf of the European Council in order to satisfy the need of a regular exchange of reliable information on migration and asylum related issues on a European level. It also serves to provide the general public with information on these subjects. 2. The Directorate-General for Migration and Home Affairs of the European Commission coordinates the EMN, assisted by service providers, in co-operation with EMN National Contact Points (EMN NCPs) in each EU Member State which are appointed by the relevant national government. EMN NCPs are located within Ministries of Interior, Ministries of Justice, specialised government agencies dealing with migration, research Institutes, non-governmental organisations and national offices of international organisations. They are located in all EU Member States (except DK). Norway, Georgia, the Republic of Moldova, Ukraine, Montenegro, Armenia and Serbia are EMN observers, but have each established EMN NCPs. For more information about each EMN NCP see the EMN members webpage. A Steering Board, consisting of representatives from each EU Member State, the European Commission and the European Parliament serves to provide the political and strategic guidance on the activities of the EMN. The EMN is funded by the European Commission through the Asylum, Migration and Integration Fund (AMIF). 3. The EMN produces reports, studies and other publications which analyse migration and asylum policies and track legislative developments in this field. The EMN publishes the latest migration and asylum related developments in a quarterly bulletin and maintains a glossary of migration and asylum-related terms. EMN outputs include: ƒ Annual reports on migration and asylum ƒ Studies on relevant topics ƒ Informs on issues of immediate priority ƒ Country factsheets ƒ Ad-hoc queries The network also organises webinars, roundtables, conferences and other events on a regular basis, both at EU and national level. 4.The EMN collaborates with other EU level agencies (e.g. European Union Agency for Asylum (EUAA), European Union Agency for Fundamental Rights (FRA), European Border and Coast Guard Agency (Frontex) and institutions and EU funded networks (e.g. the European Return and Reintegration Network and the European Integrated Return Management Initiative) on legal and irregular migration and return. It also cooperates with international organizations such as International Organization for Migration (IOM), United Nations High Commissioner for Refugees (UNHCR) and Organisation for Economic Co-operation and Development (OECD). F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 215
European Neighbourhood Policy (ENP) BG Европейска политика за съседство CS Evropská politika sousedství DE Europäische Nachbarschaftspolitik (ENP) EL Ευρωπαϊκή Πολιτική Γειτονίας EN European Neighbourhood Policy (ENP) ES Política Europea de Vecindad (PEV) Definition(s) A bilateral policy between the European Union and 16 partner countries (the EU’s closest neighbouring countries), further enriched and complemented by three regional and multilateral cooperation initiatives. Source(s) FI Euroopan naapuruuspolitiikka Description of the ENP on the Website of the European Commission and Website of the EU External Action Service FR Politique européenne de voisinage (PEV) Synonym(s) ET Euroopa naabruspoliitika GA Beartas Comharsanachta na hEorpa HR Europska politika susjedstva ENP Narrower term(s) LT Europos kaimynystės politika Black Sea Synergy Eastern Partnership (EAP) Euro-Mediterranean Partnership (EUROMED) LV Eiropas kaimiņattiecību politika Related term(s) HU európai szomszédságpolitika (ESZP) IT politica europea di vicinato (PEV) MT Politika (Il-) Ewropea tal-Viċinat / tal-Madwar NL Europees nabuurschapsbeleid PL Europejska Polityka Sąsiedztwa PT Politica Europeia de Vizinhança (PEV) RO Politica europeană de vecinătate (PEV) SK Európska susedská politika / Európska politika susedstva (ENP) SL Evropska sosedska politika SV den europeiska grannskapspolitiken NO Den europeiske naboskapspolitikken KA ევროპის სამეზობლო პოლიტიკა (ENP) UK Європейська політика сусідства (ЄПС) HY 216 Եվրոպական հարևանության քաղաքականություն Global Approach to Migration and Mobility (GAMM) EMN Asylum and Migration Classification 15.1 EU External dimension of migration and mobility Euro Voc Classification 10 European Union Note(s) 1. The ENP was developed in 2004, with the objective of avoiding the emergence of new dividing lines between the enlarged EU and its neighbours and instead strengthening the prosperity, stability and security of all. It is based on the values of democracy, rule of law and respect of human rights. 2. The three regional and multilateral cooperation initiatives of the ENP are: the Eastern Partnership (EAP), launched in Prague in May 2009; the Euro-Mediterranean Partnership (EUROMED), formerly known as the Barcelona Process, re-launched in Paris in July 2008), and the Black Sea Synergy (launched in Kiev in February 2008). 3. The Lisbon Treaty has allowed the EU to strengthen the delivery of its foreign policy: cooperation with neighbouring countries can now be broadened to cover the full range of issues in an integrated and more effective manner. This was a key driver for initiating a review of the ENP in summer 2010. 4. For up-to-date information on the ENP, see the webpage of the EU External Action Service on the ENP. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
European return liaison officer (EURLO) BG европейски служител за връзка по въпросите на връщането A B C D Definition(s) E ES Funcionario de enlace europeo para el Retorno A specialised liaison officer deployed to third countries in view of representing European Union return interests by verifying the identity of irregularly staying third-country nationals, capacity building in the field of return, supporting the organisation of joint return operations under coordination of the European Border and Coast Guard Agency (Frontex) and to facilitate the implementation of reintegration and post-arrival assistance. ET Euroopa tagasisaatmise sideohvitser Source(s) I CS Evropský styčný důstojník pro návraty DE Europäischer Verbindungsbeamter für Rückkehrfragen / Europäischer Verbindungsbeamter für Rückführungsfragen EL Αξιωματικός σύνδεσμος της ΕΕ για τις επιστροφές EN European return liaison officer (EURLO) FI Euroopan palauttamisasioiden yhteyshenkilö (EURLO) FR officier de liaison retour européen GA oifigeach idirchaidrimh um fhilleadh HR Europski časnik za vezu zadužen za vraćanje HU Európai visszatérési összekötőtiszt IT Funzionario europeo incaricato del rimpatrio LT Europos grąžinimo ryšių palaikymo pareigūnas LV Eiropas atgriešanas sadarbības koordinators MT Uffiċjal (L-) tal-Kollegament Ewropew għar-Ritorn (UKER) SL evropski uradnik za zvezo za vračanje NO Europeisk sambandsmann for retur KA დაბრუნების საკითხებში ევროპის მეკავშირე ოფიცერი (EURLO) UK Європейський співробітник зі зв’язку з питань повернення (EURLO) HY ԵՄ-ի՝ վերադարձի հարցերով երրորդ երկրներ գործուղված պատասխանատու K L M Related term(s) N Euro Voc Classification SV Europeisk sambandsman för återvändande J European return liaison officer EUR-LO PL Europejski oficer łącznikowy ds. powrotów SK Európsky styčný dôstojník pre návraty (EURLO) H Synonym(s) NL Europees verbindingsfunctionaris voor terugkeer / Europees verbindingsambtenaar voor terugkeer RO ofițer european de legătură pentru returnare G Proposal for a Regulation on the creation of a European network of immigration liaison officers (Recast), COM(2018) 303 final and European Commission Staff Working Document: Evaluation of the Council Regulation (EC)377/2004 on the creation of an immigration liaison officers network, SWD(2018)197 final. Immigration Liaison Officer (ILO) European migration liaison officer (EMLO) PT agente de ligação para o regresso F O 2811 migration P Note(s) Q 1. As a response to the immigration liaison officers (ILOs) having to take more and more tasks in the context of return, a network of return liaison officers was developed in 2013 under the Asylum, Migration and Integration Fund (AMIF), Specific Actions, aiming at increasing the number of joint return operations and enhancing integrated operational cooperation on return amongst EU/EFTA Member States, the EU Commission, partner authorities in third countries, European Border and Coast Guard Agency, international Organisations and NGOs. The EURLOs are posted in diplomatic missions of EU Member States, CH and NO. 2. Since the adoption of Council Regulation (EC) No 377/2004 (ILO-Regulation) additional specialised officers were set up for different tasks such as the EURLOs, the European Migration Liaison Officers (EMLOs) and the European Border and Coast Guard Agency Liaison Officers. 3. In 2016, the EU Commission carried out an evaluation of the ILO-Regulation of 2004 to ensure better cooperation of immigration liaisons officers, including those of the Commission and Union Agencies deployed to third countries to more effectively respond to EU priorities in terms of preventing and combating irregular migration, as well as facilitating the return of irregularly staying third-country nationals and supporting management of legal immigration. For further information see: Evaluation of the Council Regulation (EC) 377/2004 on the creation of an immigration liaison officers network: final report, 2018, and Briefing to the European Parliament: Revision of the immigration liaison officers network Regulation (EC) 377/2004. R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 217
European travel document for return BG Европейски пътен документ за връщане CS Evropský cestovní doklad pro návrat DE europäisches Reisedokument für die Rückkehr (EU-acquis); europäisches Reisedokument für die Rückführung EL ευρωπαϊκό ταξιδιωτικό έγγραφο για την επιστροφή των παρανόμως διαμενόντων υπηκόων τρίτων χωρών EN European travel document for return ES Documento de viaje europeo para el retorno ET Euroopa tagasisaatmise reisidokument FI palauttamista varten myönnettävä eurooppalainen matkustusasiakirja FR Document de voyage européen destiné au retour GA Doiciméad taistil Eorpach um fhilleadh HR Europska putna isprava za vraćanje HU visszaküldéshez kiállított európai úti okmány IT documento di viaggio europeo per il rimpatrio LT Europos kelionės dokumentas neteisėtai ES esantiems trečiųjų šalių piliečiams grąžinti Definition(s) A secure and uniform document for the return of illegally staying third-country nationals to facilitate the return and readmission of third-country nationals staying illegally on the territory of the parties to the Schengen Agreement. Source(s) Derived by EMN from Regulation (EU) 2016/1953 (Regulation establishing a European travel document for the return of illegally staying third-country nationals) Synonym(s) European travel document for the return of illegally staying third-country nationals Broader term(s) travel document Related term(s) fraudulent travel or identity document identity document Euro Voc Classification 2811 migration LV Eiropas ceļošanas dokuments personu atgriešanai MT Dokument tal-ivvjaġġar Ewropew għar-ritorn NL Europees reisdocument voor terugkeer PL Europejski dokument podróży do celów powrotu PT Documento de viagem europeu para o regresso (dos nacionais de países terceiros em situação irregular) RO document european de călătorie pentru returnare SK európsky cestovný doklad pre návrat SL evropska potna listina za vrnitev SV europeisk resehandling för återvändande av tredjelandsmedborgare NO Europeisk reisedokument for retur KA ევროპული დასაბრუნებელი სამგზავრო დოკუმენტი UK Європейський проїзний документ для повернення HY 218 ԵՄ վերադարձի ճանապարհորդական փաստաթուղթ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
European Travel Information and Authorisation System (ETIAS) BG Европейска информационна система за разрешение за пътуване A B C D Definition(s) E DE Europäisches Reiseinformations- und -genehmigungssystem An automated online system for identifying irregular migration, security or public-health risks associated with visa-exempt third-country nationals travelling to the EU prior to their arrival. EL Σύστημα πληροφοριών και άδειας ταξιδίου της ΕΕ Source(s) G CS Evropský informační systém pro cestovní povolení European Parliament, Think Tank: Briefing on the European Travel and Authorisation System (ETIAS), 18.10.2018 and Regulation (EU) 2018/1240 establishing a European Travel Information and Authorisation System (ETIASRegulation) EN European Travel Information and Authorisation System (ETIAS) ES Sistema Europeo de Información y Autorización de Viajes ET ELi reisiinfo ja -lubade süsteem FI EU:n matkustustieto- ja -lupajärjestelmä (ETIAS) F H I Synonym(s) J GA Córas an Aontais Eorpaigh um Fhaisnéis agus Údarú Taistil Related term(s) K HR Europski sustav za informacije o putovanjima i odobravanje putovanja (ETIAS) EMN Asylum and Migration Classification L FR Système européen d’information et d’autorisation concernant les voyages ETIAS HU Európai Utasinformációs és Engedélyezési Rendszer IT Sistema europeo di informazione e autorizzazione ai viaggi European Border and Coast Guard Agency (Frontex) 6.1 Entry Conditions and Procedures| 13. Irregular Migration M Euro Voc Classification 2811 migration N Note(s) O LT Europos kelionių informacijos ir leidimų sistema LV Eiropas ceļošanas informācijas un atļauju sistēma MT Sistema Ewropea ta’ Informazzjoni u Awtorizzazzjoni għall-Ivvjaġġar NL Europees systeem voor reisinformatie en -autorisatie PL Europejski System Informacji o Podróży oraz Zezwoleń na Podróż PT Sistema Europeu de Informação e Autorização de Viagem 1. The Regulation lays down the conditions under which EU Member States’ designated authorities and Europol may consult data stored in the ETIAS Central System for the purposes of the prevention, detection and investigation of terrorist offences or of other serious criminal offences falling under their competence. 2. ETIAS is managed by the European Agency for the Operational Management of Large-Scale Information Systems in the area of freedom, security and justice (eu-LISA). The central unit is part of the European Border and Coast Guard Agency (Frontex) and ensures that the data stored in the application files and the data recorded in ETIAS are correct and up to date. RO Sistemul european de informații și de autorizare privind călătoriile P Q R S SK Európsky systém pre cestovné informácie a povolenia (ETIAS) T SL Evropski sistem za potovalne informacije in odobritve U SV EU-system för reseuppgifter och resetillstånd V NO Europeisk system for reiseinformasjon og autorisasjon KA ევროკავშირის სამგზავრო ინფორმაციისა და W UK Європейська система інформації та авторизації подорожей (ETIAS) X HY Y ავტორიზაციის სისტემა (ETIAS) ԵՄ-ի ճանապարհորդական տեղեկությունների և թույլտվության համակարգ Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 219
European Union Agency for Asylum (EUAA) BG Агенция на Европейския съюз в областта на убежището CS Agentura Evropské unie pro otázky azylu DE Asylagentur der Europäischen Union (EUAA) EL Οργανισμός της Ευρωπαϊκής Ένωσης για το Άσυλο EN European Union Agency for Asylum (EUAA) ES Agencia de Asilo de la Unión Europea ET Euroopa Liidu Varjupaigaamet FI Euroopan unionin turvapaikkavirasto (EUAA) FR Agence de l’Union européenne pour l’asile (AUEA) GA Gníomhaireacht níomhaireacht an Aontais Eorpaigh um Thearmann HR Agencija Europske unije za azil (EUAA) HU Az Európai Unió Menekültügyi Ügynöksége IT Agenzia dell’Unione Europea per l’Asilo LT Europos Sąjungos prieglobsčio agentūra LV Eiropas Savienības Patvēruma aģentūra (ESPA) MT Aġenzija tal-Unjoni Ewropea għall-Ażil NL Asielagentschap van de Europese Unie PL Agencja Unii Europejskiej ds. Azylu PT Agência da União Europeia para o Asilo RO Agenția Uniunii Europene pentru Azil SK Agentúra Európskej únie pre azyl (EUAA) SL Agencija Evropske unije za azil SV Europeiska unionens asylbyrå NO Den europeiske unions asylbyrå KA ევროპის თავშესაფრის სააგენტო (EUAA) UK Агентство Європейського Союзу з питань притулку (EUAA) HY 220 Եվրոպական միության ապաստանի գործակալություն Definition(s) European Union agency tasked with ensuring the efficient and uniform application of EU law on asylum, international protection and reception conditions in the EU Member States in a manner that fully respects fundamental rights, and with facilitating and supporting the activities of EU Member States in the implementation of the Common European Asylum System (CEAS). Source(s) Derived by EMN from Art.1 of Regulation (EU) 2021/2303 (EUAA Regulation) and the Website of the EUAA Synonym(s) EUAA EU Agency for Asylum European Union Agency for Asylum Broader term(s) international protection Related term(s) Common European Asylum System (CEAS) European Asylum Support Office (EASO) European Border and Coast Guard Agency (Frontex) European Migration Network (EMN) European Union Agency for Fundamental Rights (FRA) General Directors’ Immigration Services Conference (GDISC) EMN Asylum and Migration Classification 2.2 EU (e.g. Common European Asylum System, Qualification Directive, European Agenda for Migration)| 4.1 International protection Euro Voc Classification 1006 EU institutions and European civil service| 2811 migration EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. On 19 January 2022, the European Union Agency for Asylum (EUAA) was established by Regulation (EU) 2021/2302 (EUAA Regulation). The EUAA replaces and succeeds the European Asylum Support Office (EASO) which was established in 2010 and took up its responsibilities on 1 February 2011. 2. The Agency acts as a resource for EU Member States in the field of international protection, with the ability to provide practical, legal, technical, advisory and operational assistance in many formats, as well as training. The aim of the Agency’s activities is to enable convergence in the assessment of applications for international protection across EU Member States and to harmonise asylum practice. 3. Among other tasks the Agency ƒ facilitates, coordinates and strengthens practical cooperation among EU Member States on their asylum and reception systems; ƒ gathers and analyses qualitative and quantitative information on the situation of asylum in EU Member States and on the implementation of the CEAS including monitoring the operational and technical application of the CEAS; ƒ develops operational standards, indicators, guidelines and best practices in regard to the implementation of the CEAS; ƒ drafts common country of origin reports and develops common analysis and guidance notes on countries of origin; ƒ deploys liaison officers to EU Member states, sets up and deploys asylum support teams and an asylum reserve pool for EU Member States under pressure; ƒ assists with relocation and resettlement activities; ƒ supports EU Member States in their cooperation with third countries in matters related to the external dimension of the CEAS, including through the deployment of liaison officers to third countries. (For more information see Art. 2 of the EUAA-Regulation). 4. The EUAA cooperates closely with the asylum and immigration authorities of the EU Member States and with the European Commission. However, the Agency does not replace the national asylum or reception authorities, nor does it have any powers in relation to the decisions of EU Member States’ asylum authorities on individual applications for international protection. 5. The EUAA cooperates with the Union bodies, offices and agencies which carry out activities in the field of international protection and reception with the aim to creating synergies and avoiding duplication of efforts as well as with international organisations, in particular the United Nations High Commissioner for Refugees (UNHCR). For more information see Articles 4, 37 and 38 of the EUAA Regulation. 6. For more information on the EUAA, see the website of the EUAA. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 221
European Union Agency for Criminal Justice Cooperation (Eurojust) BG CS Agentura Evropské unie pro justiční spolupráci v trestních věcech DE Agentur der Europäischen Union für justizielle Zusammenarbeit in Strafsachen (Eurojust) / Eurojust EL Οργανισμός της Ευρωπαϊκής Ένωσης για τη συνεργασία στον τομέα της ποινικής δικαιοσύνης (Eurojust) LV Eiropas Savienības Aģentūra tiesu iestāžu sadarbībai krimināllietās MT Aġenżija tal-Unjoni Ewropea għall-Kooperazzjoni fil-Qasam tal-Ġustizzja Kriminali (Eurojust) NL Agentschap van de Europese Unie voor justitiële samenwerking in strafzaken (Eurojust) PL Agencja Unii Europejskiej ds. Współpracy Wymiarów Sprawiedliwości w Sprawach Karnych EN European Union Agency for Criminal Justice Cooperation (Eurojust) PT Eurojust - Agência Europeia para a Cooperação Judiciária Penal ES Agencia de la Unión Europea para la Cooperación Judicial Penal (Eurojust) RO Agenția Uniunii Europene pentru Cooperarea în Materie de Justiție Penală (Eurojust) ET Euroopa Liidu Kriminaalõigusalase Koostöö Amet (Eurojust) SK Agentúra Európskej únie pre justičnú spoluprácu v trestných veciach (Eurojust) / Eurojust FI Euroopan unionin rikosoikeudellisen yhteistyön virasto (Eurojust) SL Agencija Evropske unije za pravosodno sodelovanje v kazenskih zadevah / Eurojust FR Agence de l’Union européenne pour la coopération judiciaire en matière pénale (Eurojust) SV Europeiska unionens byrå för straffrättsligt samarbete (Eurojust) GA NO (Eurojust) EUs byrå for strafferettssamarbeid HR Agencija Europske unije za suradnju u kaznenom pravosuđu (Eurojust) KA სისხლის სამართლის სფეროში HU Az Európai Unió Büntető Igazságügyi Együttműködési Ügynöksége (Eurojust) IT LT Europos Sąjungos bendradarbiavimo baudžiamosios teisenos srityje agentūra (Eurojust) 222 თანამშრომლობის ევროკავშირის სააგენტო (Eurojust) UK Агентство Європейського Союзу з питань співробітництва у сфері кримінальної юстиції (Євроюст) HY EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Եվրոպական միության քրեական արդարադատության գործակալություն (Եվրաջասթ)
A B C Definition(s) European Union agency that provides tailor-made support to prosecutors and judges from across the EU and beyond to fight a wide range of serious and complex cross-border crimes involving two or more countries, including smuggling of migrants and trafficking in human beings. Source(s) Derived by EMN from the Website of Eurojust and IATE Synonym(s) Eurojust European Union Agency for Criminal Justice Cooperation Related term(s) European Border and Coast Guard Agency (Frontex) European Union Agency for Law Enforcement Cooperation (Europol) EMN Asylum and Migration Classification 2.2 EU (e.g. Common European Asylum System, Qualification Directive, European Agenda for Migration)| 13.1 Migrant smuggling| 13.2 Trafficking in human beings D Note(s) 1. Eurojust’s analytical and operational work makes the Agency a key actor in the judicial response to migrant smuggling and trafficking in human beings in the EU. 2. Since each participating EU Member State has a national member at Eurojust, the Agency is able to coordinate parallel investigations in several countries where victims of trafficking in human beings are recruited, exploited and transported through or moved. To combat trafficking in human beings, Eurojust assists the national judicial authorities inter alia in the following areas: ƒ gathering evidence and sharing information; ƒ creating joint investigation teams; ƒ swift execution of judicial cooperation tools; ƒ identification, localisation, protection and welfare of victims; ƒ coordinating with third countries; ƒ sharing expertise on trafficking in human beings. 3. The investigations coordinated through Eurojust aim to cover criminal activity along all major migrant smuggling routes to the European Union. The cases regularly involve the full participation of third countries. Eurojust has designated contact points in non-EU countries with whom it can liaise at both strategic and operational level in specific cases. Furthermore, Eurojust helps involved authorities to develop links with relevant European and international organisations. 4. To further strengthen the fight against migrant smuggling, Eurojust launched a Focus Group of Prosecutors and Investigative Judges Fighting Migrant Smuggling in April 2020. It is composed of prosecutors and investigative judges from EU Member States specialised in migrant smuggling cases and brings together all concerned actors in the security and criminal justice chain. Europol’s European Migrant Smuggling Centre (EMSC) also joined this new initiative. E F G H I J K L M N O Euro Voc Classification 1216 criminal law| 1221 justice| 2811 migration P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 223
European Union Agency for Fundamental Rights (FRA) BG Агенция на Европейския съюз за основните права CS Agentura Evropské unie pro základní práva Definition(s) ES Agencia de Derechos Fundamentales de la Unión Europea An European Union agency which provides independent, evidence-based advice on fundamental rights to the relevant institutions and authorities of the European Union and the EU Member States in order to support them when implementing Union law, taking measures or formulating courses of action within their respective spheres of competence to fully respect fundamental rights. ET Euroopa Liidu Põhiõiguste Amet Source(s) DE Agentur der Europäischen Union für Grundrechte EL Οργανισμός Θεμελιωδών Δικαιωμάτων της Ευρωπαϊκής Ένωσης EN European Union Agency for Fundamental Rights (FRA) FI Euroopan unionin perusoikeusvirasto FR Agence des droits fondamentaux de l’Union européenne Art. 2 of Council Regulation (EC) No 168/2007 (FRA Regulation) Synonym(s) HR Agencija Europske unije za temeljna prava (FRA) European Fundamental Rights Agency FRA Fundamental Rights Agency HU Az Európai Unió Alapjogi Ügynöksége Broader term(s) GA Gníomhaireacht an Aontais Eorpaigh um Chearta Bunúsacha IT Agenzia dell’Unione Europea per i Diritti Fondamentali LT Europos Sąjungos pagrindinių teisių agentūra fundamental rights Related term(s) PT Agência dos Direitos Fundamentais da UE Charter of Fundamental Rights of the European Union European Border and Coast Guard Agency (Frontex) European Union Agency for Asylum (EUAA) European Convention on Human Rights (ECHR) European Migration Network (EMN) human rights RO Agenţia pentru Drepturi Fundamentale a Uniunii Europene 1006 EU institutions and European civil service LV Eiropas Savienības Pamattiesību aģentūra MT Aġenzija tal-Unjoni Ewropea għad-Drittijiet Fundamentali NL Bureau van de Europese Unie voor de grondrechten PL Agencja Praw Podstawowych Unii Europejskiej SK Agentúra Európskej únie pre základné práva (FRA) SL Agencija Evropske unije za temeljne pravice SV Europeiska unionens byrå för grundläggande rättigheter NO Den europeiske unions byrå for grunnleggende rettigheter (b); Byrået for grunnleggjande rettar i Den europeiske unionen (n) KA ევროკავშირის ძირითად უფლებათა სააგენტო (FRA) Euro Voc Classification Note(s) 1. The European Union Agency for Fundamental Rights was inaugurated on 1 March 2007. It was established by Council Regulation (EC) No 168/2007 (FRA Regulation) as the successor to the European Monitoring Centre on Racism and Xenophobia (EUMCI). 2. Its tasks, which are laid down in Art. 4 of the Regulation, include information and data collection, research and analysis; advice to EU institutions and EU Member States; cooperation with civil society and awareness raising. 3. For more information, see the website of FRA. UK Агентство Європейського Союзу з основних прав (FRA) HY 224 Եվրոպական միության հիմնարար իրավունքների գործակալություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 225
European Union Agency for Law Enforcement Cooperation (Europol) BG Европол CS Agentura Evropské unie pro spolupráci v oblasti prosazování práva/ Europol NL Agentschap van de Europese Unie voor samenwerking op het gebied van rechtshandhaving (Europol) DE Agentur der Europäischen Union für die Zusammenarbeit auf dem Gebiet der Strafverfolgung (Europol) / Europol PL Europol - Europejski Urząd Policji PT Europol - Agência da União Europeia para a Cooperação Policial EL Ευρωπόλ (Europol) / Οργανισμός της ΕΕ για τη συνεργασία στον τομέα της επιβολής του νόμου RO Agenția Uniunii Europene pentru Cooperare în Materie de Aplicare a Legii (Europol) EN European Union Agency for Law Enforcement Cooperation (Europol) SK Agentúra Európskej únie pre spoluprácu v oblasti presadzovania práva (Europol) / Europol ES Europol SL Agencija Evropske unije za sodelovanje na področju preprečevanja, odkrivanja in preiskovanja kaznivih dejanj / Europol ET Euroopa Liidu Õiguskaitsekoostöö Amet (Europol) FI Euroopan unionin lainvalvontayhteistyövirasto (Europol) FR Agence de l’Union européenne pour la coopération des services répressifs (Europol) GA Europol HR Europol (EUs organisasjon for politisamarbeid) HU A Bűnüldözési Együttműködés Európai Uniós Ügynöksége (Europol) SV Europeiska unionens byrå för samarbete inom brottsbekämpning (Europol) NO Den europeiske unions organisasjon for kriminalitetsbekjempelse og politisamarbeid (Europol) (b); Organisasjonen i den europeiske union for kriminalitetsbekjemping og politisamarbeid (Europol) (n) KA ევროკავშირის სამართალდაცვით სფეროში თანამშრომლობის სააგენტო.(Europol/ ევროპოლი) IT Europol LT Europolas LV Eiropas Savienības Aģentūra tiesībaizsardzības sadarbībai (Eiropols) MT Aġenzija tal-Unjoni Ewropea għall-Kooperazzjoni fil-Qasam tal-Infurzar tal-Liġijiet (Europol) 226 UK Агентство Європейського Союзу зі співробітництва правоохоронних органів (Європол) HY EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Եվրոպոլ / Եվրոպական Միության իրավապահ համագործակցության գործակալություն
A B C Definition(s) European Union agency which assists EU Member States’ police forces in improving their cooperation on the prevention and fight against all forms of serious international and organised crime, including smuggling of migrants and trafficking in human beings, especially via its European Migrant Smuggling Centre (EMSC). Source(s) Derived by EMN from the Website of Europol Synonym(s) European Police Office Related term(s) European Union Agency for Criminal Justice Cooperation (Eurojust) EMN Asylum and Migration Classification 13.3 Crimes related to migration Euro Voc Classification 10 European Union D Note(s) 1. The establishment of the European Police Office was agreed to in the Treaty on the European Union (TEU) that came into effect in November 1993. The agency started limited operations on 3 January 1994, as the Europol Drugs Unit (EDU). The Europol Convention was signed on 26 July 1995, and came into force in October 1998 after being ratified by all EU Member States. Europol commenced its full activities on 1 July 1999. Europol came under the European Union’s competence with the Lisbon Treaty, and the Convention was replaced by a Council Decision in 2009.It was reformed as a full EU agency on 1 January 2010. 2. Europol which is based in The Hague serves as an European Union centre of expertise, providing a central platform for law enforcement experts from the European Union countries. Europol’s analytical and operational work usually consists of dealing with crimes that require an international approach and cooperation between several countries, inside and outside the EU. The decision on which crimes to prioritise is shaped by the European Multidisciplinary Platform Against Criminal Threats (EMPACT). Mi-grant smuggling and trafficking in human beings are among the current priorities. 3. Europol has no executive powers. Europol officers are not entitled to conduct investigations in the EU Member States nor do they have direct powers of arrest. Supporting police and border authorities to coordinate anti-smuggling operations is the primary objective of the EMSC established in 2016. The EMSC closely cooperates with its partner EU Agencies dealing with judicial cooperation (European Union Agency for Criminal Justice Cooperation (Eurojust)) and border management (European Border and Coast Guard Agency (Frontex)). E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 227
European Union Emergency Trust Fund for Africa (EUTF for Africa) BG Европейски доверителен фонд за спешна помощ за Африка LT Europos Sąjungosskubiosios pagalbos Afrikai patikos fondas CS Svěřenecký fond Evropské unie pro Afriku LV Eiropas Savienības Ārkārtas trasta fonds Āfrikai DE Nothilfe-Treuhandfonds der Europäischen Union für Afrika MT Fond Fiduċjarju ta’ Emerġenza tal-Unjoni Ewropea għall-Afrika EL Ευρωπαϊκό καταπιστευματικό Ταμείο εκτάκτου ανάγκης για την Αφρική / Ταμείο Αρωγής εκτάκτου ανάγκης για τη σταθερότητα και την αντιμετώπιση των βαθύτερων αιτίων της παράνομης μετανάστευσης στην Αφρική NL EU Noodfonds voor Afrika EN European Union Emergency Trust Fund for Africa (EUTF for Africa) RO Fondul fiduciar de urgență al Uniunii Europene pentru Africa (EUTF pentru Africa) ES Fondo fiduciario de emergencia de la Unión Europea para África SK Núdzový trustový fond Európskej únie pre Afriku / Núdzový zverenecký fond Európskej únie pre Afriku / Núdzový trustový fond EÚ pre stabilitu a riešenie základných príčin neregulárnej migrácie a vysídľovania osôb v Afrike (EUTF for Africa) ET Euroopa Liidu Aafrika hädaolukorra usaldusfond FI Euroopan Unionin Afrikka-hätärahasto FR Fonds fiduciaire d’urgence de l’Union européenne pour l’Afrique GA Ciste Iontaobhais Éigeandála an Aontais Eorpaigh don Afraic PL Fundusz Powierniczy UE na rzecz Afryki PT Fundo Fiduciário de Emergência da UE para África SL Nujni skrbniški sklad EU za Afriko SV Europeiska unionens förvaltningsfond för nödåtgärder i Afrika HR Krizni uzajamni fond EU-a za Afriku NO European Union Emergency Trust Fund for Africa (no usual translation) HU Uniós Szükséghelyzeti Alap Afrikáért KA ევროკავშირის საგანგებო სიტუაციების IT Fondo fiduciario d’emergenza dell’Unione Europea per l’Africa სატრასტო ფონდი აფრიკისთვის (EUTF აფრიკისთვის) UK Надзвичайний трастовий фонд ЄС для Африки HY 228 EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Եվրոպական Միության Արտակարգ իրավիճակների օգնության հիմնադրամ Աֆրիկայի համար
A B C D Definition(s) Fund aiming to foster stability in a wide range of countries across Africa that encompass the major migration routes to Europe and to contribute to better migration management by addressing the root causes of destabilisation, forced displacement and irregular migration and by promoting economic and equal opportunities, security and development and a tighter Africa-EU cooperation on issues of migration control, return and readmission. E Source(s) I F G H Website of the EUTF for Africa and Factsheet on the EUTF for Africa J Synonym(s) EU Emergency Trust Fund for Africa European Union Emergency Trust Fund for stability and addressing root causes of irregular migration and displaced persons in Africa EUTF for Africa K L M EMN Asylum and Migration Classification 15.1 EU External dimension of migration and mobility N Euro Voc Classification 10 European Union O Note(s) P 1. The EUTF for Africa was formally adopted at the Valletta Summit on 12 November 2015 by EU Member States, CH, NO and 23 African countries (the Sahel region and Lake Chad, the Horn of Africa and the North of Africa). 2. It focuses on the following areas: a) economic programs with particular attention to employment creation; b) resilience projects geared to improving food security and to providing services for local communities and refugees; c) migration management, including fight against irregular migration and smuggling of migrants, return, readmission and reintegration, international protection and asylum, legal migration and mobility; d) governance and security, including interventions in the fields of rule of law, security and development, border management and conflict-prevention systems. Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 229
Eurostat BG Евростат CS Eurostat Definition(s) DE Eurostat The Statistical Office of the European Union within the European Commission. EL Ευρωπαϊκή Στατιστική Υπηρεσία Source(s) EN Eurostat Website of Eurostat ES Eurostat Related term(s) ET Eurostat European Migration Network (EMN) FI Eurostat Euro Voc Classification FR Eurostat GA Eurostat HR Eurostat HU Eurostat IT Eurostat LT Afrikai patikos fondas LV Eurostat MT Eurostat (L-) NL Eurostat PL Eurostat PT Eurostat RO Eurostat SK Štatistický úrad Európskych spoločenstiev / Eurostat SL Eurostat 1006 EU institutions and European civil service Note(s) 1. Eurostat was established in 1953. 2. Its task is to provide the European Union with statistics at European level that enable comparisons between countries and regions. 3. The European Migration Network (EMN) cooperates with Eurostat by harmonising statistics from the European Statistical System (ESS) to a single methodology, making the statistics comparable. 4. Regulation (EC) No 862/2007 (Migration Statistics Regulation) establishes common rules for the collection and compilation of Community statistics (for submission to Eurostat) on: (a) immigration and emigration flows; (b) citizenship and country of birth of persons usually resident in the territory of the EU Member States; c) administrative and judicial procedures and processes in the EU Member States relating to immigration, granting of permission to reside, citizenship, asylum and other forms of international protection and prevention of irregular migration. 5. For more information, see the website of Eurostat. SV Eurostat NO Eurostat KA ევროსტატი (Eurostat) UK Євростат HY 230 Եվրոպական վիճակագրական ծառայություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B evidence assessment BG оценка на доказателствата CS hodnocení důkazů DE Beweiswürdigung EL Αξιολόγηση αποδεικτικών στοιχείων EN evidence assessment ES Prueba de evaluación ET tõendite hindamine FI todisteiden arviointi FR évaluation des éléments de preuve GA measúnú fianaise HR procjena dokaza HU bizonyítékok értékelése IT valutazione delle prove LT įrodymų vertinimas C D Definition(s) Primary method of establishing the facts of an individual case through the process of examining and comparing available pieces of evidence. Source(s) F EASO: Practical Guide on Evidence Assessment. - March 2015. G EMN Asylum and Migration Classification H Euro Voc Classification I 6.3 Specific aspects of migration procedures 12 Law J Note(s) The term is not only relevant in the context of international protection and asylum but in other migration procedures such as visa application procedures as well. K L LV pierādījumu izvērtēšana MT Valutazzjoni tal-evidenza M NL beoordeling van het bewijs PL ocena dowodu N PT avaliação da prova RO evaluarea probelor O SK hodnotenie dôkazov SL presoja dokazov P SV bevisvärdering NO bevisvurdering Q KA მტკიცებულებათა შეფასება R UK оцінка доказів HY E ապացուցման տվյալների գնահատում S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 231
examination of an application for international protection BG разглеждане на молба за международна закрила CS posouzení žádosti o mezinárodní ochranu DE Prüfung eines Antrags auf internationalen Schutz EL εξέταση αίτησης διεθνούς προστασίας EN examination of an application for international protection ES examen de una solicitud de protección internacional ET rahvusvahelise kaitse taotluse läbivaatamine FI kansainvälistä suojelua koskevan hakemuksen käsittely FR examen d’une demande de protection internationale Definition(s) Any examination of, or decision or ruling concerning, an application for international protection by the competent authorities in accordance with Directive 2013/32/EU (Recast Asylum Procedures Directive) and Directive 2011/95/EU (Recast Qualification Directive) , except for procedures for determining the EU Member State responsible in accordance with Regulation (EU) No 604/2013 (Dublin III Regulation) . Source(s) Art. 2(d) of Regulation (EU) No 604/2013 (Dublin III Regulation) GA iniúchadh ar iarratas ar chosaint idirnáisiúnta Broader term(s) HR odlučivanje o osnovanosti zahtjeva za međunarodnu zaštitu EMN Asylum and Migration Classification HU nemzetközi védelem iránti kérelem vizsgálata IT esame della domanda di protezione internazionale LT tarptautinės apsaugos prašymo nagrinėjimas (EU acquis); prašymo suteikti prieglobstį nagrinėjimas application for international protection 6.2 Procedure for international protection/Refugee status determination Euro Voc Classification 1011 European Union law| 2811 migration LV starptautiskās aizsardzības pieteikuma izskatīšana MT Tgħarbil / Eżami ta’ applikazzjoni għall-protezzjoni internazzjonali NL behandeling van een verzoek om internationale bescherming PL rozpatrywanie wniosku o udzielenie ochrony międzynarodowej PT análise de um pedido de proteção internacional RO examinarea unei cereri de protecție internațională SK posúdenie žiadosti o medzinárodnú ochranu / posúdenie žiadosti o udelenie medzinárodnej ochrany (EU acquis); posúdenie žiadosti o udelenie azylu SL obravnavanje prošnje za mednarodno zaščito SV prövning av ansökan om internationellt skydd NO vurdering av søknad om internasjonal beskyttelse (b); vurdering av søknad om internasjonalt vern (n) KA საერთაშორისო დაცვის მოთხოვნის შესახებ განცხადების განხილვა UK розгляд заяви про надання міжнародного захисту HY 232 միջազգային պաշտպանության դիմումի քննություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B exclusion clause BG изключваща клауза CS exkluzivní klauzule / vylučovací klauzule DE Ausschlussklausel EL ρήτρα αποκλεισμού EN exclusion clause ES cláusula de exclusión ET välistav klausel FI poissulkemislauseke FR clause d’exclusion GA clásal eisiaimh C D Definition(s) Specifically, any of the provisions of the Geneva Refugee Convention and Protocol, such as articles 1D, 1E and 1F, which mandatorily deny the benefits of refugee status to persons who already received UN or national protection, or to persons about whom there are good reasons to believe that they have committed a war crime, a crime against humanity, a serious non-political crime, or acts contrary to the purposes and principles of the UN (e.g. the persecution of others). E Source(s) I HR klauzula isključenja Art. 1D, 1E and 1F of the Geneva Refugee Convention and Protocol HU kizáró klauzulák Related term(s) F G H J LT prašymo atmetimo pagrindai crime against humanity war crime K LV izslēgšanas noteikums EMN Asylum and Migration Classification L Euro Voc Classification M IT clausola di esclusione MT Klawsola ta’ tbarrija / t’esklużjoni NL uitsluitingsgronden PL klauzula wykluczenia PT cláusulas de exclusão RO cauză de excludere SK doložka o vylúčení / vylučovacia klauzula / vylučovacie ustanovenie SL izključitvena klavzula 4.1 International protection 1011 European Union law| 1231 international law| 2811 migration N Note(s) O The EU asylum acquis (see for example Art. 12 and 17 of Directive 2011/95/EU (Recast Qualification Directive) has incorporated these Geneva Refugee Convention clauses whilst additionally stipulating exclusion clauses in relation to subsidiary protection. P SV undantagsklausul / uteslutandeklausul Q NO unntaksbestemmelse (b); unntaksføresegn (n) KA გამორიცხვის დებულება R UK застереження про виключення HY S բացառման պայման T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 233
ex-nunc examination BG ex-nunc проверки /проверки, които следва да бъдат направени от даден момент нататък CS ex-nunc přezkum DE Ex-nunc-Prüfung; Entscheidung ohne Neuerungsverbot (AT) EL ex nunc εξέταση EN ex-nunc examination ES Examen ex nunc ET ex-nunc läbivaatamine Definition(s) In appeals procedures, a court’s or tribunal’s consideration of the evidence of the situation (all elements, facts and points of law) available at the moment of the decision, thus allowing courts or tribunals to take into account evidence of which the administration could not have been aware during the first instance procedure. Source(s) FI ex nunc -tutkinta Art. 46 (3) of Directive 2013/32/EU (Recast Asylum Procedures Directive) FR examen ex-nunc Synonym(s) GA scrúdú ex-nunc ex nunc examination HR ex nunc razmatranje EMN Asylum and Migration Classification HU ex-nunc vizsgálat IT Esame ex-nunc LT ex nunc nagrinėjimas LV ex nunc pārbaude 6.2.4 Second instance (Administrative or judicial) determination procedure / Appeals Procedure Euro Voc Classification 12 Law MT Eżami ex-nunc NL ex nunc onderzoek / ex nunc toetsing PL postępowanie dowodowe ex nunc PT exame ex-nunc RO examinare ex-nunc SK preskúmanie ex nunc SL ex-nunc presoja SV ex nunc-prövning NO helhetsvurdering av den aktuelle situasjonen (ved anke) (b); heilskapsvurdering av den aktuelle situasjonen (ved anke) (n) KA ექს ნუნკ (ex nunc/”ამ მომენტიდან”) განხილვა UK дослідження ex-nunc HY 234 որոշման պահին առկա իրավիճակի բոլոր ապացույցները EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B exodus BG no usual translation CS exodus DE Exodus EL (μαζική) έξοδος EN exodus ES éxodo ET massiline väljaränne FI joukkopako FR exode / fuite massive GA imeacht HR egzodus HU kivonulás IT esodo LT egzodas C D Definition(s) Movements in groups (isolated and sporadic) out of a country of origin in large numbers or of a section of the community at a given time. Source(s) Developed by EMN F G EMN Asylum and Migration Classification 1. Framework Concepts on Migration (including root causes of migration H Euro Voc Classification I 2811 migration J Note(s) A similar definition is also used in the UNHCR International Thesaurus of Refugee Terminology definition. K L LV masveida izceļošana MT Eżodu M NL uittocht / exodus PL exodus N PT êxodo RO exod O SK exodus / hromadný odchod SL eksodus P SV massflykt NO masseutvandring / masseflukt Q KA მასობრივი გამგზავრება R UK масовий виїзд HY E (զանգվածային) արտահոսք S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 235
exploitation BG експлоатация CS vykořisťování DE Ausbeutung EL εκμετάλλευση EN exploitation ES explotación ET ärakasutamine FI hyväksikäyttö FR exploitation Definition(s) The act of taking advantage of something or someone, in particular the act of taking unjust advantage of another for one’s own benefit (e.g. sexual exploitation, forced labour or services, slavery or practices similar to slavery, servitude or the removal of organs). Source(s) Developed by EMN Related term(s) GA dúshaothrú forced labour trafficking in human beings HR iskorištavanje EMN Asylum and Migration Classification HU kizsákmányolás IT sfruttamento LT išnaudojimas LV izmantošana MT Sfruttament NL uitbuiting PL wykorzystywanie PT exploração 13.3 Crimes related to migration Euro Voc Classification 44 Employment and Working Conditions Note(s) Art. 2(3) of Directive 2011/36/EU (Anti-Trafficking Directive) states that exploitation includes, as a minimum, the exploitation of the prostitution of others or other forms of sexual exploitation, forced labour or services, including begging, slavery or practices similar to slavery, servitude, or the exploitation of criminal activities, or the removal of organs. RO exploatare SK vykorisťovanie SL izkoriščanje SV utnyttjande NO utnyttelse (b); utnytting (n) KA ექსპლუატაცია UK експлуатація HY 236 շահագործում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B expulsion BG експулсиране CS vyhoštění C ES expulsión Removal of a third-country national subject to an expulsion decision based, on the one hand, on a present serious threat to public order or to national security and safety or, on the other hand, on failure to comply with national rules on the entry or residence of aliens. ET väljasaatmine Source(s) DE Rückführung (EU acquis); Ausweisung (DE) EL απέλαση EN expulsion D Definition(s) E F G H FI maastapoistaminen (EU acquis); karkotus/ maastakarkotus Derived by EMN from Art. 3(1) of Council Directive 2001/40/EC (Expulsion Directive). FR éloignement (EU acquis); expulsion (BE, FR, LU) Broader term(s) I GA díbirt / ionnarbadh removal HR protjerivanje Narrower term(s) J HU kiutasítás (when implemented with official escort: kitoloncolás) expulsion decision IT espulsione 2811 migration K Euro Voc Classification L LT išsiuntimas LV izraidīšana MT Espulsjoni / Tkeċċija NL verwijdering / uitzetting / uitwijzing PL wydalenie PT expulsão RO expulzare / returnare (forţată) sub escortă SK vyhostenie Note(s) A serious threat to public order or to national security and safety is presumed in the following cases: ƒ conviction of a third-country national by the issuing EU Member State for an offence punishable by a penalty involving deprivation of liberty of at least one year; ƒ the existence of serious grounds for believing that a third-country national has committed serious criminal offences or the existence of solid evidence of their intention to commit such offences within the territory of an EU Member State. SL izgon N O P Q SV avvisning / utvisning NO utvisning (b); utvising (n) R KA გაძევება UK видворення HY M S վտարում T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 237
expulsion decision BG решение за експулсиране CS rozhodnutí o vyhoštění DE Rückführungsentscheidung (EU acquis); Ausweisungsentscheidung (DE, LU) EL απόφαση απέλασης Definition(s) Administrative or judicial decision laying the legal basis for an expulsion. Source(s) EN expulsion decision Derived by EMN from Art. 2(b) of Council Directive 2001/40/EC (Expulsion Directive) and IATE. ES decisión de expulsión Synonym(s) ET väljasaatmisotsus expulsion order FI maastapoistamispäätös Broader term(s) FR décision d’éloignement (EU acquis); décision d’expulsion (BE, FR, LU) expulsion GA cinneadh ionnarbtha HR rješenje o protjerivanju enforcement measure removal order HU kiutasítást elrendelő határozat Euro Voc Classification IT decisione di espulsione LT sprendimas išsiųsti / sprendimas dėl išsiuntimo LV izraidīšanas lēmums MT deċiżjoni ta’ espulsjoni / ta’ tkeċċija NL verwijderingsbesluit PL decyzja o wydaleniu Related term(s) 2811 migration Note(s) 1. The decision can be taken by a competent administrative (or judicial) authority of an issuing EU Member State. 2.  In DE, only expulsion order is used, while expulsion decision and expulsion order are understood in the same way. In RO, expulsion is decided by the courts only, not by administration. PT decisão de afastamento RO decizie de expulzare SK rozhodnutie o vyhostení SL odločba o izgonu SV beslut om avvisning eller utvisning NO utvisningsbeslutning (b); utvisingsavgjerd (n) KA გადაწყვეტილება გაძევების შესახებ UK рішення про видворення HY 238 վտարման որոշում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
external dimension of EU migration and asylum policy BG външно измерение на политиката на ЕС в областта на миграцията и убежището A B C D Definition(s) CS vnější rozměr migrační a azylové politiky EU DE externe Dimension der Migrations- und Asylpolitik der EU / externe Dimension der EU-Migrations- und Asylpolitik EL εξωτερική διάσταση της πολιτικής της ΕΕ για τη μετανάστευση και το Άσυλο The European Union’s external relationships with key third countries of origin, transit and return with the aim to manage migration through tailor-made partnerships. E Source(s) G F Derived by EMN from the European Commission: Communication on a New Pact on Migration and Asylum, COM(2020) 609 final EN external dimension of EU migration and asylum policy ES dimensión externa de la política de la UE en materia de migración y asilo ET ELi rände- ja varjupaigapoliitika välismõõde Related term(s) I Global Approach to Migration and Mobility (GAMM) EMN Asylum and Migration Classification J Euro Voc Classification K 15.1 EU External dimension of migration and mobility FI EU:n turvapaikka- ja maahanmuuttopolitiikan ulkoinen ulottuvuus 1011 European Union law| 2811 migration FR dimension extérieure de la politique de l’UE en matière de migration et d’asile GA gné sheachtract bheartas imirce agus tearmainn an Aontais Eorpaigh HR vanjska dimenzija EU azilne i migracijske politike HU az EU migrációs és menekültügyi politikájának külső dimenziója IT Dimensione esterna della politica europea in materia di migrazione e asilo LT išoriniai ES migracijos ir prieglobsčio politikos aspektai LV ES migrācijas un patvēruma politikas ārējā dimensija MT Dimensjoni esterna tal-politika dwar il-migrazzjoni u l-ażil ta-UE NL externe dimensie van het EU-migratie- en asielbeleid PL wymiar zewnętrzny polityki migracyjnej i azylowej UE PT dimensão externa da política de migração e asilo da UE RO dimensiunea externă a politicii UE în domeniul migrației și azilului SK vonkajšia dimenzia migračnej a azylovej politiky EÚ / vonkajší rozmer migračnej a azylovej politiky EÚ / externá dimenzia migračnej a azylovej politiky EÚ / externý rozmer migračnej a azylovej politiky EÚ H L Note(s) 1. Since 2015, migration management and the search for readmission agreements have taken an important place in the EU›s external relations with third countries of origin, transit or return. The New Pact on Migration and Asylum 2020 reaffirms this objective in Chapter 6. It builds on the Global Approach to Migration and Mobility (GAMM), the current overarching framework for EU migration and asylum policies, launched in 2011, but goes beyond and aims to reinforce international partnerships with a view to ensuring effective returns, combating smuggling of migrants more effectively, and developing legal migration channels. 2. Cooperation with third countries shall take place within the framework of comprehensive, balanced and tailored partnerships based on a joint assessment of the interests of both the EU and its partner countries. Taking into account the specific situation of each partner country or region, it is based on a combination of the following aspects: ƒ Protecting refugees and people in need of international protection and supporting refugee-host countries; ƒ Developing legal pathways to the European Union; ƒ Supporting well-managed legal migration, including through new talent partnerships; ƒ Addressing root causes of irregular migration; ƒ Reinforcing partner countries’ capacities on migration management and governance, including on border management and combating smuggling of migrants; ƒ Fostering cooperation on return, readmission and reintegration. 3. For more information see: European Parliament: Briefing: The external dimension of the New Pact on Migration and Asylum, a focus on prevention and readmission, April 2021. M N O P Q R S T U V SL zunanja razsežnost migracijske in azilne politike W SV den yttre dimensionen av EU:s migrations- och asylpolitik X NO Den eksterne dimensjonen i EUs asyl- og migrasjonspolitikk KA ევროკავშირის მიგრაციისა და თავშესაფრის Y UK зовнішній вимір політики ЄС щодо міграції та надання притулку Z პოლიტიკის გარე განზომილება HY ԵՄ միգրացիայի և ապաստանի քաղաքականության արտաքին ուղղություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0 239
external EU border BG външна граница на ЕС CS vnější hranice EU DE EU-Außengrenze EL εξωτερικά σύνορα της ΕΕ EN external EU border ES frontera exterior (UE) ET EL välispiir Definition(s) The parts of a Schengen Member State’s border, including land borders, river and lake borders, sea borders and their airports, river ports, sea ports and lake ports, that are not common borders with another Schengen Member State. Source(s) FI EU:n ulkoraja Derived by EMN from Art.2(2) of Regulation (EU) 2016/399 (Schengen Borders Code) FR frontière extérieure de l’UE Related term(s) GA teorainn sheachtrach AE HR vanjska granica EU-a HU az EU külső határa IT frontiera esterna UE LT ES išorės siena LV ES ārējā robeža MT Konfini (Il-) esterni / Fruntiera (Il-) esterna tal-UE NL EU buitengrens PL granica zewnętrzna UE PT fronteira externa RO frontiere externe UE SK vonkajšia hranica EÚ SL zunanja meja EU SV yttre EU-gräns NO ytre grense for Schengen-medlemsland KA ევროკავშირის გარე საზღვარი border control internal EU border irregular entry legal entry refusal of entry Schengen Borders Code EMN Asylum and Migration Classification 6.1.1 Border control Euro Voc Classification 1011 European Union law Note(s) 1. IE does not participate in the Schengen Area. 2. BG and RO are Schengen candidate countries. 3. IS, LI, NO and CH are also Schengen Member States, although they are not EU Member States. 4. For updated information on membership to the Schengen Area, see the description of EU policies on borders and visas and Schengen on the website of DG HOME. UK зовнішній кордон ЄС HY 240 ԵՄ արտաքին սահմաններ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B facilitator C BG помагач D Definition(s) CS osoba napomáhající In the context of migration, any person who, for financial or other gain, intentionally assists a person who is not a national of a country to enter, or transit across its territory or to reside within its territory in breach of the laws of the country concerned. DE Schlepper EL διαμεσολαβητής EN facilitator ES traficante de personas Source(s) E F G ET välismaalase ebaseaduslikult üle riigipiiri toimetaja/ ilma seadusliku aluseta riigis viibimise soodustaja/ vahendaja Derived by EMN from Article 1(1)(a) and (b) of Council Directive 2002/90/EC (Directive defining the facilitation of unauthorised entry, transit and residence) FI säännösten vastaisen maahantulon järjestäjä Narrower term(s) I Related term(s) J FR personne qui facilite l’entrée, le transit ou le séjour irréguliers d’un étranger smuggler GA éascaitheoir smuggling of migrants trafficking in human beings HR pomagač HU szándékosan segítséget nyújtó személy Euro Voc Classification LV cilvēku tirdzniecības veicinātājs N Note(s) NL facilitator PL pośrednik PT facilitador RO traficant de persoane / persoană care introduce ilegal migranți SK sprostredkovateľ / prevádzač SL sprovajalec SV medhjälpare till olaglig inresa och vistelse NO tilrettelegger for menneskesmugling (b); tilrettelegg for menneskesmugling (n) HY M 2811 migration MT Faċilitatur (-triċi) Ħaffief(a) UK помічник L 13.1 Migrant smuggling LT tarpininkas KA ხელშემწყობი პირი K EMN Asylum and Migration Classification IT colui il quale compie reato di favoreggiamento dell’immigrazione irregolare / trafficante di esseri umani H 1. Even though both terms are closely linked to each other and relate to the phenomenon of irregular migration, there is a difference between a facilitator and a smuggler. 2. Facilitator is the broader concept and means a person who provides services beyond the unauthorized entry of a migrant into a country. Facilitators offer a support system or backup structure to the criminal operations of smugglers. They are more involved in the active organization of channels, networks, entry points and operating in the transnational organized crime. Their system often relies on the use of legal business and intermediators, acting as enablers. These can be as numerous and diverse as internet service providers, transport and logistic firms, hotels, financial services, travel or employment agencies and/or landlords. For more information see: Glossary Human Trafficking, 2019. 3. Smuggling of migrants is the narrower concept and enables the transport of a person (with their consent) to another country through illegal means. For more information see the entry for smuggler in this glossary. 4. In some states the term ‘facilitator’ has a completely different meaning and is used in other contexts than irregular migration. O P Q R S T U միջնորդ V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 241
False and Authentic Documents Online (FADO) BG Онлайн система за фалшиви и истински документи CS Falešné a pravé doklady online DE Falsche und echte Dokumente online EL Πλαστά και γνήσια έγγραφα οnline EN False and Authentic Documents Online (FADO) ES Documentos falsos y auténticos en línea ET Võltsitud ja ehtsad dokumendid veebis FI Aitojen ja väärennettyjen asiakirjojen sähköinen tietokanta (FADO) Definition(s) A European Union internet-based image-archiving system set up to support the rapid sharing between EU Member States of images of genuine, false and forged documents in order to aid the combating of irregular migration and the use of fraudulent documents. Source(s) Derived by EMN from information in the Summary of Joint Action 98/700/JHA concerning the setting up of a European image-archiving system FR Faux documents et documents authentiques en ligne (FADO) Synonym(s) GA Doiciméid Bhréagacha agus Bharantúla ar Líne Related term(s) HR Europski sustav slikovnog arhiviranja (FADO) FADO HU hamis és eredeti okmányok online rendszere Public Register of Authentic Travel and Identity Documents Online (PRADO) IT Documenti falsi e autentici online EMN Asylum and Migration Classification LT Klastoti ir autentiški dokumentai internete LV viltoti un autentiski dokumenti tiešsaistē / FADO MT Dokumenti Foloz u Awtentiċi Onlajn NL Fraudedocumenten en Authentieke Documenten Online PL Fałszywe i Autentyczne Dokumenty Elektroniczne PT documentos falsos e autênticos on-line RO Sistemul european de arhivare a imaginilor (FADO) SK Falošné a pravé doklady online (FADO) SL lažne in pristne listine na spletu SV falska och äkta handlingar online NO nettbasert referansedatabase for falske og ekte dokumenter KA ყალბი და ავთენტიკური დოკუმენტების ონლაინკატალოგი (FADO) 13. Irregular Migration| 14.4 Technological factor and impacts (digitalization of processes v paper processes) Euro Voc Classification 2811 migration Note(s) 1. FADO was established by a Joint Action of the Council of the European Union enacted in 1998. 2. Based on Article 2 of the Joint Action establishing the system, the database contains among other things: ƒ images of false and forged documents; ƒ images of genuine documents; ƒ summary information on forgery techniques; ƒ summary information on security techniques. 3. Access to FADO is currently limited to document experts of the 31 FADO partner states (all EU Member States and IC, NO, and CH) 4. Part of the information in the classified, restricted system, FADO, is made publicly available, via the Public Register of Authentic Travel and Identity Documents Online (PRADO) website which is managed by the Council of the European Union. UK Онлайн база підроблених та автентичних документів (FADO) HY 242 Կեղծ և իսկական փաստաթղթեր առցանց EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B false declaration of parenthood BG невярна декларация за родителство C D Definition(s) CS falešné prohlášení rodičovství GA bréagdhearbhú tuismíochta An untruthful declaration of a relationship of parenthood which does not actually exist either (a) between a minor who is an union citizen or settled third-country national and a third-country national adult, where the adult claims to be the parent in order to obtain or legalise their residence in a EU Member State, or (b) between a third-country national minor and a union citizen adult or a settled third-country national adult where the adult declares themselves parent of the minor in order to obtain or legalise the residence of the child and / or possibly the residence of the other parent. HR lažna izjava o roditeljstvu Source(s) DE falsche Erklärung der Elternschaft / falsche Elternschaftsangabe EL ψευδής δήλωση πατρότητας EN false declaration of parenthood ES declaración falsa de paternidad / maternidad ET põlvnemise kohta valeandmete esitamine FI valheellinen vanhemmuuden ilmoittaminen FR fausse déclaration de parentalité HU hamis szülői nyilatkozat Developed by EMN IT falsa dichiarazione di filiazione false declaration of paternity LV vecāku statusa viltus reģistrēšana civil partnership of convenience marriage of convenience partnership of convenience NL valse ouderschapsverklaring PL fałszywe oświadczenie o uznaniu rodzicielstwa SL lažna izjava o starševstvu SV osant intygande om föräldraskap NO falsk vedgåelse av foreldreskap (b); falsk vedgåing av foreldreskap (n) 2811 migration P Note(s) Q For more information on false declarations of parenthood, see EMN website: Misuse of family reunification, 2012. R KA ცრუ განცხადება მშობლობის შესახებ UK неправдива заява про батьківство HY J O Euro Voc Classification SK falošné prehlásenie rodičovstva I N 6.3 Specific aspects of migration procedures RO declaraţie de paternitate falsă H M EMN Asylum and Migration Classification PT falsas declarações parentesco G L Related term(s) MT Dikjarazzjoni falza ta’ maternità u / jew paternità F K Narrower term(s) LT fiktyvus įvaikinimas E S ծնողների վերաբերյալ կեղծ հայտարարություն T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 243
family formation BG създаване на семейство CS sloučení rodiny DE Familienbildung EL δημιουργία οικογένειας EN family formation ES formación de la familia ET pere loomise eesmärgil riiki sisenemine FI perheenmuodostaminen FR constitution de la famille GA foirmiú teaghlaigh HR zasnivanje obitelji HU családalapítás Definition(s) The entry into and residence in an EU Member State of a third-country national on the basis of the establishment of a family relationship either a) after their third-country national sponsor has gained legal residence in an EU Member State; or (b) with an EU national. Source(s) Developed by EMN Broader term(s) family reunification Related term(s) MT Kompożizzjoni / Tiswira tal-familja chain migration family migration nuclear family right to family life right to family unity NL gezinsvorming EMN Asylum and Migration Classification IT costituzione di una famiglia LT šeimos kūrimas LV ģimenes veidošana PL założenie rodziny PT reagrupamento familiar RO formarea familiei SK založenie rodiny SL ustanovitev družine SV familjebildning NO familiedannelse (b); familiedanning (n) KA ოჯახის შექმნა 3.2 Migration for Family Reasons Euro Voc Classification 2806 family| 2811 migration Note(s) 1. This term is specific to some EU Member States, particularly BE, NL, SE. In UK, this relates to the formation of family between a UK national and a third-country national only. 2. In other EU Member States, family formation is covered under family reunification. UK створення сім’ї HY 244 ընտանիքի կազմ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 245
family member BG член на семейство CS rodinný příslušník DE Familienangehöriger EL μέλος οικογένειας EN family member ES miembro de la familia ET perekonnaliige FI perheenjäsen FR membre de (la) famille GA duine muinteartha HR član obitelji HU családtag IT membro della famiglia / familiare LT šeimos narys LV ģimenes loceklis MT Membru tal-familja NL gezinslid PL członek rodziny PT membro da familia RO membru de familie / membru al familiei SK rodinný príslušník / člen rodiny SL družinski član SV familjemedlem NO familiemedlem KA ოჯახის წევრი UK член сім’ї HY 246 ընտանիքի անդամ Definition(s) In the general migration context, a person either married to, or having a relationship legally recognised as equivalent to marriage, to a migrant, as well as their dependent children or other dependants who are recognised as members of the family by applicable legislation. In the context of the Family Reunification Directive (Directive 2003/86(EC), a third-country national, as specified in Art. 4 of this Directive (normally members of the nuclear family -i.e. the spouse and the minor children), who has entered the territory of the European Union for the purpose of family reunification. In the context of the Free Movement Directive (Directive 2004/38 EC): (a) the spouse; (b) the partner with whom the union citizen has contracted a registered partnership, on the basis of the legislation of a EU Member State, if the legislation of the host Member State treats registered partnerships as equivalent to marriage and in accordance with the conditions laid down in the relevant legislation of the host Member State; (c) the direct descendants who are under the age of 21 or are dependants and those of the spouse or partner as defined in point (b); (d) the dependent direct relatives in the ascending line and those of the spouse or partner as defined in point (b). In the context of asylum, and in particular Regulation (EU) No 604/2013 (Dublin III Regulation) , this means insofar as the family already existed in the country of origin, the following members of the applicant’s family who are present on the territory of the EU Member States: a) the spouse of the applicant or their unmarried partner in a stable relationship, where the law or practice of the EU Member State concerned treats unmarried couples in a way comparable to married couples under its law relating to third-country national; b) the minor children of couples referred to in the first indent or of the applicant, on condition that they are unmarried and regardless of whether they were born in or out of wedlock or adopted as defined under national law; c) when the applicant is a minor and unmarried, the father, mother or another adult responsible for the applicant, whether by law or by the practice of the Member State where the adult is present; EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Source(s) E General: Derived by EMN from Art. 4 of UN Convention on the Protection of All Migrant Workers and Members of their Families Family reunification: Recital 9 and Art. 4 of Council Directive 2003/86/EC (Family Reunification Directive) Free movement: Art. 2(2) of Directive 2004/38/EC (Free Movement Directive) Asylum: Art. 2(g) of Regulation (EU) No 604/2013 (Dublin III Regulation) F G H I Related term(s) dependant family reunification nuclear family sponsor J K EMN Asylum and Migration Classification L 3.2 Migration for Family Reasons Euro Voc Classification M 2806 family| 2811 migration N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 247
family migration BG миграция с цел създаване или събиране на семейство CS migrace za účelem sloučení rodiny DE Familienmigration EL οικογενειακή μετανάστευση EN family migration ES migración por motivos familiares Definition(s) In the global context, a general concept encompassing family reunification, family formation, and migration of an entire family at the same time. In the EU context, a concept which refers explicitly to family reunification and family formation. Source(s) FR migration pour des raisons familiales Global context: Derived by EMN from the discussion of types of family migration in Chapter 6 of IOM World Migration Report 2008 EU context: Developed by EMN GA imirce teaghlaigh Related term(s) ET pereränne FI perheperusteinen maahanmuutto HR obiteljske migracije HU családi okokból történő migráció IT migrazione familiare LT šeimos migracija LV ģimenes migrācija MT Migrazzjoni għal raġunijiet ta’ familja NL gezinsmigratie PL migracja rodzinna chain migration family formation family reunification right to family unity EMN Asylum and Migration Classification 3.2 Migration for Family Reasons Euro Voc Classification 2806 family| 2811 migration PT migração familiar RO migraţia în scopul reîntregirii familiei SK migrácia z rodinných dôvodov SL družinske migracije SV familjemigration NO familiemigrasjon KA ოჯახის მიგრაცია UK сімейна міграція HY 248 ընտանեկան միգրացիա EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B family reunification BG събиране на семейство CS sloučení rodiny C D Definition(s) GA athaontú teaghlaigh The establishment of a family relationship which is either: a) the entry into and residence in an EU Member State, in accordance with Council Directive 2003/86/EC (Family Reunification Directive), by family members of a thirdcountry national residing lawfully in that EU Member State (‹sponsor›) in order to preserve the family unit, whether the familiy relationship arose before or after the entry of the sponsor; or b) between an union citizen and third-country national established outside the European Union who then subsequently enters the European Union. HR spajanje obitelji Source(s) DE Familienzusammenführung EL οικογενειακή επανένωση EN family reunification ES reagrupación familiar ET perekonna taasühinemine FI perheenyhdistäminen FR regroupement familial; réunification familiale (pour les familles de réfugiés) (FR) HU családegyesítés IT ricongiungimento familiare LT šeimos susijungimas LV ģimenes apvienošana / ģimenes atkalapvienošana MT Riunifikazzjoni tal-familja NL gezinshereniging PL łączenie rodzin PT reagrupamento familiar RO reîntregirea familie / reunificarea familiei SK zlúčenie rodiny SL združitev družine SV familjeåterförening NO familiegjenforening (b); familiegjenforeining (n) KA ოჯახის გაერთიანება UK возз’єднання сім’ї HY ընտանիքի վերամիավորում Part (a): Art. 2 (d) of Council Directive 2003/86/EC (Family Reunification Directive) Part (b): Developed by EMN E F G H I J K L Synonym(s) family reunion M Broader term(s) right to family unity N Narrower term(s) family formation O Related term(s) chain migration family member family migration right to family life P EMN Asylum and Migration Classification R Euro Voc Classification S Q 3.2 Migration for Family Reasons 2806 family| 2811 migration T Note(s) 1. Art. 5(3) of Council Directive 2003/86/EC (Family Reunification Directive) also covers ‘reunification’ when a third-country national is already resident in the European Union under different permissions (e.g. a residence permit for the purpose of remuneration or study). 2. In FR, ‘réunification familiale’ is only used when referring to family members of beneficiaries of international protection. U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 249
family tracing BG Проследяване на семейството CS vyhledávání členů rodiny DE Suche nach Familienmitgliedern EL εντοπισμός της οικογένειας EN family tracing ES localización familiar ET perekonnaliikmete otsimine FI perheenjäsenten jäljittäminen FR recherche des familles GA Teaghlach a lorg HR traganje za članovima obitelji HU családi kapcsolatok felkutatása IT indagini familiari LT šeimos narių paieška Definition(s) Search for family members, including relatives or former caregivers of unaccompanied minors and separated children, with the aim of ensuring the restoration of family links and the right of family unity. Source(s) Derived by EMN from: EASO practical guide on family tracing, March 2016 and UN General comment No. 6: Treatment of Unaccompanied and Separated Children Outside their Country of Origin, 2005 Broader term(s) family member Related term(s) LV ģimenes locekļu meklēšana best interests of the child (BIC) right to family unity MT Tiftix (Tfittxija) għal tal-familja /għal membri tal-familja EMN Asylum and Migration Classification PL poszukiwanie rodziny 3.2 Migration for Family Reasons| 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) PT localização das famílias Euro Voc Classification NL opsporing van familieleden RO depistarea familiei 2806 family SK pátranie po rodinných príslušníkoch / vyhľadávanie rodinných príslušníkov Note(s) SL iskanje družine SV familjespårning NO familesporing KA ოჯახის მოძიება UK пошук членів сім’ї HY 250 ընտանիքի որոնում 1. Family tracing can be applied in different migration procedures. It is primarily done for unaccompanied minors and separated children with the aim of ensuring the best interests of the child (BIC) in the respective procedure. 2. In the EU context, separated children are covered by unaccompanied minors. 3. According to Art. 6(4) of Regulation (EU) No 604/2013 (Dublin III Regulation) , the EU Member State where an unaccompanied minor lodged an application for international protection shall as soon as possible take appropriate action to identify family members, siblings or relatives of the unaccompanied minor in the territory of the EU Member State whilst protecting the best interests of the child. 4. The understanding of this term may vary in the EU Member/EFTA States. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B female genital mutilation BG генитално осакатяване на жени CS ženská obřízka DE weibliche Genitalverstümmelung EL ακρωτηριασμός γυναικείων γεννητικών οργάνων EN female genital mutilation ES Mutilación genital femenina ET naiste suguelundite moonutamine FI naisten sukuelinten silpominen FR mutilations génitales féminines / mutilations sexuelles féminines GA ciorrú baill ghiniúna ban HR spolno sakaćenje žena HU női nemiszerv-csonkítás All procedures which involve the partial or total removal of the external genitalia or other injury to the female genital organs whether for cultural or any other nonmedical reasons. E Source(s) G Synonym(s) H Website of the World Health Organisation FGM cutting circumcision female circumcision LV sieviešu dzimumorgānu kropļošana EMN Asylum and Migration Classification F I J Related term(s) LT moters lytinių organų žalojimas MT Mutilazzjoni ġenitali tan-nisa D Definition(s) gender-based persecution gender-specific violence social group IT mutilazione genitale femminile C K L NL vrouwelijke genitale verminking 7.1 Women (pregnant women, victims of female genital mutilation) M PL okaleczanie żeńskich organów płciowych Euro Voc Classification N Note(s) O PT mutiliação genital feminina RO mutilare genitală a femeilor SK mrzačenie ženských pohlavných orgánov / zmrzačovanie ženských pohlavných orgánov SL pohabljanje ženskih spolovil SV kvinnlig könsstympning NO kvinnelig kjønnslemlestelse (b); kvinneleg kjønnslemlesting (n) KA ქალის სასქესო ორგანოების დასახიჩრება UK калічення жіночих статевих органів HY կանանց սեռական օրգանների անդամահատում 1. FGM is recognized internationally as a violation of the human rights of women and girls. The practice also violates a person›s rights to health, security and physical integrity; the right to be free from torture and cruel, inhuman or degrading treatment; and the right to life when the procedure results in death. The practice of FGM is considered as a criminal act in all EU Member States. 2.The United Nations High Commissioner for Refugees (UNHCR) Guidance Notes of 2009 state that a girl or woman seeking asylum because she has been compelled to undergo, or is likely to be subjected to FGM may qualify for refugee status under the Geneva Refugee Convention and Protocol. The UNHCR Guidelines consider FGM to be a form of gender-specific violence that inflicts severe mental and physical harm and amounts to persecution. For further information see UNHCR Guidance Note on Refugee Claims relating to Female Genital Mutilation, 2009 . P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 251
final decision BG окончателно решение CS pravomocné rozhodnutí / konečné rozhodnutí DE rechtskräftige Entscheidung EL οριστική απόφαση (EL); τελική απόφαση (CY) EN final decision ES resolución definitiva ET lõplik otsus FI lainvoimainen päätös FR décision finale GA cinneadh críochnaitheach Definition(s) A decision on whether the third-country national or stateless person be granted refugee status or subsidiary protection status by virtue of Directive 2011/95/EU (Recast Qualification Directive) and which is no longer subject to a remedy within the framework of Chapter V of this Directive, irrespective of whether such remedy has the effect of allowing applicants to remain in the EU Member State concerned pending its outcome. Source(s) HR izvršna odluka Art. 2(e) of Directive 2013/32/EU (Recast Asylum Procedures Directive) HU jogerős határozat EMN Asylum and Migration Classification IT decisione definitiva LT galutinis sprendimas LV galīgais lēmums MT Deċiżjoni finali 6.2 Procedure for international protection/Refugee status determination Euro Voc Classification 1011 European Union law| 2811 migration NL definitieve beslissing PL ostateczna decyzja PT decisão final RO decizie finală SK konečné rozhodnutie SL pravnomočna odločba SV slutligt beslut NO endelig vedtak (b); endeleg avgjerd (n) KA საბოლოო გადაწყვეტილება UK остаточне рішення HY 252 վերջնական որոշում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 253
final decision rejecting an application for international protection BG окончателно решение за отхвърляне на молба за международна закрила LV galīgais lēmums, ar ko noraida starptautiskās aizsardzības pieteikumu CS konečné rozhodnutí o zamítnutí žádosti o mezinárodní ochranu MT DE endgültige Entscheidung, mit der ein Antrag auf internationalen Schutz abgelehnt wird EL οριστική απόφαση απόρριψης αίτησης διεθνούς προστασίας (EL), τελική απόφαση απόρριψης αίτησης διεθνούς προστασίας (CY) EN final decision rejecting an application for international protection ES decisión firme de denegación de una solicitud de protección internacional ET rahvusvahelise kaitse andmisest keeldumise lõplik otsus FI kansainvälistä suojelua koskevan hakemuksen lopullinen hylkäämispäätös FR décision définitive de rejet d’une demande de protection internationale GA cinneadh críochnaitheach lena ndiúltaítear iarratas ar chosaint idirnáisúnta NL definitieve beslissing tot afwijzing van een verzoek om internationale bescherming PL decyzja ostateczna odrzucająca wniosek o udzielenie ochrony międzynarodowej PT Decisão definitiva de indeferimento de um pedido de proteção internacional RO decizie irevocabilă privind respingerea cererii pentru protecție internațională / decizia finală de respingere a unei cereri de protecție internațională SK konečné rozhodnutie zamietajúce žiadosť o medzinárodnú ochranu SL pravnomočna odločba o zavrnitvi prošnje za mednarodno zaščito SV slutligt beslut om att avslå ansökan om internationellt skydd NO endelig vedtak om avslag på søknad om internasjonal beskyttelse (b); endeleg vedtak om avslag på søknad om internasjonalt vern (n) HR konačna odluka kojom se odbija međunarodna zaštita KA საბოლოო გადაწყვეტილება საერთაშორისო HU nemzetközi védelem iránti kérelmet elutasító jogerős határozat UK остаточне рішення про відмову в проханні про міжнародний захист IT decisione definitiva di rigetto di una domanda di protezione internazionale HY დაცვის მინიჭებაზე უარის თქმის შესახებ LT galutinis sprendimas dėl tarptautinės apsaugos prašymo atmetimo 254 EMN ASYLUM AND MIGRATION GLOSSARY 10.0 միջազգային պաշտպանության դիմումի մերժման վերջնական որոշում
A B C D Definition(s) Decision to reject an application for international protection which is no longer subject to a remedy. E Source(s) F Derived by EMN from Art. 4 (3b) of Regulation (EC) No 862/2007 (Migration Statistics Regulation) G Broader term(s) H final decision Related term(s) I rejected applicant for international protection EMN Asylum and Migration Classification 6.2 Procedure for international protection/Refugee status determination J Euro Voc Classification K 1011 European Union law| 2811 migration L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 255
first country of asylum BG първа страна на убежище CS první země azylu Definition(s) ET esmane varjupaigariik A country in which an applicant for international protection has either (a) been recognised as a refugee and they can still avail themselves of that protection; or (b) otherwise enjoys sufficient protection, including benefiting from the principle of non-refoulement, provided that they will be readmitted to that country. FI ensimmäinen turvapaikkamaa Source(s) DE erster Asylstaat / erstes Asylland EL πρώτη χώρα ασύλου EN first country of asylum ES primer país de asilo FR premier pays d’asile GA an chéad tír thearmainn HR prva država azila HU első menedék országa IT paese di primo asilo LT pirmoji prieglobsčio šalis LV pirmā patvēruma valsts MT L-Ewwel art / pajjiż tal-ażil NL eerste land van asiel PL kraj pierwszego azylu PT primeiro país de asilo RO prima ţară de azil SK prvá krajina azylu SL prva država azila SV första asylland Art. 35 of Directive 2013/32/EU (Recast Asylum Procedures Directive) Synonym(s) country of first asylum first asylum principle EMN Asylum and Migration Classification 4.1 International protection Euro Voc Classification 1011 European Union law| 2811 migration Note(s) 1. In applying the concept of ‘first country of asylum’ to the particular circumstances of an applicant, EU Member States may take into account Art. 38(1) of the Directive 2013/32/EU (Recast Asylum Procedures Directive) (‘concept of safe third country’). 2. In accordance with relevant legislation, an applicant shall be allowed to challenge the application of the first country of asylum concept in relation to their particular circumstances. NO første asylland KA პირველი თავშესაფრის ქვეყანა UK перша країна притулку HY 256 ապաստանի առաջին երկիր EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B first instance decision BG решение на първа инстанция CS rozhodnutí v prvním stupni / prvostupňové rozhodnutí DE erstinstanzliche Entscheidung EL απόφαση πρώτου βαθμού (EL); πρωτοβάθμια απόφαση (CY) EN first instance decision ES resolución en primera instancia ET esimese astme otsus C D Definition(s) E In the context of international protection, an appealable decision to grant or deny either refugee status or subsidiary protection status issued by an EU Member State›s determining authority after examination of an application for international protection. F G Source(s) H FI ensimmäinen päätös Derived by EMN from Directive 2013/32/EU (Recast Asylum Procedures Directive) FR décision en première instance Related term(s) I GA cinneadh céadchéime final decision HR prvostupanjska odluka EMN Asylum and Migration Classification J HU elsőfokú döntés IT decisione di primo grado LT pirmosios instancijos teismo sprendimas LV pirmās instances lēmums 6.2.3 First Instance (Administrative) determination procedure K Euro Voc Classification L 1011 European Union law| 2811 migration MT deċiżjoni fil-prima istanza M NL beslissing in eerste aanleg N PL decyzja w pierwszej instancji PT Decisão de primeira instância RO ecizie în primă instanță O SK rozhodnutie správneho orgánu prvého stupňa / prvostupňové rozhodnutie / rozhodnutie prvého stupňa P SL prvostopenjska odločba Q SV beslut i första instans R NO vedtak i første instans KA პირველი ინსტანციის გადაწყვეტილება S UK рішення першої інстанції HY առաջին ատյանի որոշում T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 257
Five plus Five (5+5) Dialogue on Migration in the Western Mediterranean BG 5+5 диалог по въпросите на миграцията в Западното Средиземноморие CS Dialog 5+5 o migraci v západním Středomoří DE 5+5 Dialog über Migration im Westlichen Mittelmeerraum EL 5+5 Διάλογος για τη Μετανάστευση για τη Δυτική Μεσόγειο EN Five plus Five (5+5) Dialogue on Migration in the Western Mediterranean Definition(s) A trans-Mediterranean forum set up as a security initiative to secure closer cooperation between five EU Member States and five Arab Maghreb countries through political dialogue and economic cooperation, and by encouraging more efficient management of resources as a means of enhancing regional interdependence and development. Source(s) ES Diálogo 5+5 sobre migración en el Mediterráneo Occidental IOM website on the 5+5 Dialogue ET 5+5 Vahemere lääneosa rände dialoog FI Välimeren länsiosan maiden muuttoliikeaiheinen 5+5-vuoropuhelu 5+5 Dialogue Western Mediterranean Forum FR Dialogue 5+5 sur la migration en Méditerranée occidentale GA Idirphlé 5+5 maidir leis an Imirce i réigiún na Meánmhara Thiar HR 5 + 5 Dijalog o migracijama u zapadnom Sredozemlju HU 5+5 Nyugat- Mediterrán Migrációs Párbeszéd Synonym(s) Related term(s) Dialogue on Mediterranean Transit Migration Global Approach to Migration and Mobility (GAMM) Rabat Process EMN Asylum and Migration Classification 15.1 EU External dimension of migration and mobility Euro Voc Classification IT Dialogo 5+5 sulle Migrazioni nel Mediterraneo Occidentale 10 European Union LT Vakarų Viduržemio jūros regiono valstybių dialogas „5+5“ migracijos klausimais LV 5+5 Vidusjūras rietumu valstu dialogs par migrāciju MT Djalogu 5+5 fuq il-Migrazzjoni fil-Punent tal‑Mediterran NL 5+5 dialoog over migratie in het Westelijke Middellandsezeegebied PL 5+5 Dialog na rzecz migracji w zachodniej części Morza Śródziemnego Note(s) 1. The Western Mediterranean Forum, commonly referred to as the 5+5 Dialogue, was officially launched in Rome in 1990. 2. The five Arab Maghreb countries are Algeria, Libya, Mauritania, Morocco and Tunisia, the 5 EU Member States are FR, IT, MT, PT and ES, the forum is facilitated by the International Organization for Migration (IOM). Its areas of activity are information exchange, joint management of international borders, agreed forms of labour migration, migration for development, and protection of the rights of migrants in the Western Mediterranean region. 3. For more information see the IOM website on the 5+5 Dialogue. PT Diálogo 5+5 para o Mediterrâneo ocidental RO 5+5 Dialog cu privire la migraţie în zona vest Mediteraneeană SK Dialóg 5+5 o migrácii v západnom Stredomorí SL 5+5 Dialog o migracijah v zahodnem Sredozemlju SV 5+5-dialogen / dialog mellan länderna i västra Medelhavsområdet NO 5+5-dialog om migrasjon i det vestre Middelhavet KA 5+5 დიალოგი მიგრაციის საკითხებზე დასავლეთ ხმელთაშუაზღვისპირეთში UK Діалог «п’ять плюс п’ять» (5+5) про міграцію в Західному Середземномор’ї HY Արեվմտյան Միջերկրական երկրների 5+5 Երկխոսություն միգրացիայի շուրջ 258 EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B forced labour BG принудителен труд CS nucená práce DE Zwangsarbeit EL καταναγκαστική εργασία EN forced labour ES trabajo forzoso ET sunnitöö FI pakkotyö FR travail forcé GA obair éigeantais HR prisilini rad C D Definition(s) All work or service which is exacted from any person under the menace of any penalty and for which the said person has not offered themselves voluntarily. Source(s) E F Art. 2(1) of ILO Convention No. 29, 1930 (Forced Labour Convention) G Synonym(s) H compulsory labour compulsory work I Related term(s) HU kényszermunka child labour exploitation J IT lavoro forzato EMN Asylum and Migration Classification K LT priverstinis darbas LV piespiedu darbs MT Xogħol furzat / ta’ bilfors NL gedwongen arbeid (NL); dwangarbeid (BE) PL praca przymusowa PT trabalho forçado 1. Framework Concepts on Migration (including root causes of migration| 14.2 Economic factors and impacts (such as brain drain/gain, employment/ unemployment, labour market, economic growth, dumping) Euro Voc Classification 4416 organisation of work and working conditions M N RO muncă forţată O SK nútená práca SL prisilno delo P SV tvångsarbete NO tvangsarbeid Q KA იძულებითი შრომა R UK примусова праця HY L հարկադիր աշխատանք S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 259
forced marriage BG брак по принуда CS nucený sňatek DE Zwangsheirat Definition(s) The union of two persons, at least one of whom has not given their full and free consent to the marriage. EL εξαναγκαστικός γάμος (EL); καταναγκαστικός γάμος (CY) Source(s) EN forced marriage EMN Asylum and Migration Classification ES matrimonio forzado ET sundabielu FI pakkoavioliitto Art. 4 of Council of Europe Resolution 1468 (2005) 14. Factors and Impacts of Migration Euro Voc Classification 12 Law| 2806 family FR mariage forcé GA pósadh éigeantais HR prisilni brak HU kényszerházasság IT matrimonio forzato LT priverstinė santuoka LV piespiedu laulības MT Żwieġ sfurzat / ta’ bilfors NL gedwongen huwelijk PL przymusowe małżeństwo PT casamento forçado RO căsătorie forţată SK nútené manželstvo SL prisilna poroka / prisilna sklenitev zakonske zveze SV tvångsäktenskap NO tvangsekteskap KA იძულებითი ქორწინება UK примусовий шлюб HY 260 հարկադիր ամուսնություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B forced migrant BG мигрант по принуда CS nucený migrant DE Zwangsmigrant EL μετανάστης εξ ανάγκης EN forced migrant ES migrante forzoso ET sundsisserändaja (no usual translation) FI pakkomuuttaja FR migrant forcé GA imirceach éigeantais HR prisilni migrant HU kényszermigráns IT migrante forzato LT priverstinis migrantas LV piespiedu migrants MT Migrant(a) kostrett(a) / sfurzat(a) NL gedwongen migrant PL migrant przymusowy PT migrante forçado C A person subject to a migratory movement in which an element of coercion exists, including threats to life and livelihood, whether arising from natural or man-made causes (e.g. movements of refugees and internally displaced persons as well as people displaced by natural or environmental disasters, chemical or nuclear disasters, famine or development projects). E Source(s) H Broader term(s) I Narrower term(s) J Developed by EMN migrant displaced person refugee M EMN Asylum and Migration Classification SK nútený migrant Euro Voc Classification N O 2811 migration P SV ofrivillig migrant NO tvungen migrant Q KA იძულებითი მიგრანტი R UK вимушений мігрант HY G L de facto refugee economic migrant forced migration RO migrant forţat F K Related term(s) 1. Framework Concepts on Migration (including root causes of migration SL prisilni migrant D Definition(s) հարկադիր միգրանտ S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 261
forced migration BG принудителна миграция CS nucená migrace DE Zwangsmigration / erzwungene Migration EL αναγκαστική μετανάστευση EN forced migration ES migración forzosa ET sundränne FI pakkomuutto FR migration forcée GA imirce éigeantais HR prisline migracije HU kényszermigráció IT migrazione forzata LT priverstinė migracija LV piespiedu migrācija MT Migrazzjoni kostretta / sfurzata NL gedwongen migratie PL migracja przymusowa Definition(s) A migratory movement in which an element of coercion exists, including threats to life and livelihood, whether arising from natural or man-made causes (e.g. movements of refugees and internally displaced persons as well as people displaced by natural or environmental disasters, chemical or nuclear disasters, famine or development projects). Source(s) Developed by EMN Broader term(s) migration Narrower term(s) displacement Related term(s) economic migration forced migrant managed migration EMN Asylum and Migration Classification PT migração forçada 1. Framework Concepts on Migration (including root causes of migration RO migraţie forţată Euro Voc Classification SK nútená migrácia 2811 migration SL prisilne migracije SV ofrivillig migration / påtvingad migration NO tvangsmigrasjon KA იძულებითი მიგრაცია UK примусова міграція HY 262 հարկադիր միգրացիա EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B forced return BG принудително връщане CS nucený návrat DE Zwangsrückführung / zwangsweise Rückführung / erzwungene Rückkehr EL αναγκαστική επιστροφή / αναγκαστικός επαναπατρισμός / ακούσια επιστροφή EN forced return ES retorno forzoso ET sunniviisiline tagasipöördumine / tagasisaatmine FI pakkopaluu / pakkopalauttaminen FR retour forcé GA filleadh éigeantach HR prisilno udaljenje HU kötelező visszatérés IT Ritorno forzato / Rimpatrio forzato LT priverstinis grąžinimas C D Definition(s) In the global context, compulsory return of an individual to the country of origin, transit or third country (i.e. country of return), on the basis of an administrative or judicial act. In the EU context, the voluntary or enforced compliance with an obligation to return to - one’s country of origin; or - a country of transit in accordance with EU or bilateral readmission agreements or other arrangements; or - another third country, to which the third-country national concerned voluntarily decides to return and in which they will be accepted. E Source(s) K Global context: Developed by EMN EU context: Art. 3(3) of Directive 2008/115/EC (Return Directive) F G H I J L LV piespiedu atgriešana (EU acquis); piespiedu izraidīšana Synonym(s) M MT Ritorn ta’ bilfors / Ripatriazzjoni obbligatorja Broader term(s) N Narrower term(s) O NL gedwongen terugkeer / verplichte terugkeer PL przymusowy powrót PT retorno forçado compulsory return return SL prisilno vračanje / prisilna vrnitev expulsion extradition removal voluntary departure SV återvändande med tvång Related term(s) RO returnare forțată / returnare sub escortă SK nútený návrat NO tvangsretur return decision KA იძულებითი დაბრუნება Euro Voc Classification UK примусове повернення HY հարկադիր վերադարձ P Q R 2811 migration S Note(s) T 1. In the global context, forced return is a broader term which includes any action having the effect of returning the individual to a State, including expulsion, removal, extradition, rejection at the frontier, extra-territorial interception and physical return. 2. The term ‘forced return’ is not used at all in European Union legislation. Council Directive 2008/115/EC (Return Directive) which regulates the return of migrants whose stay has been found to be illegal refers to return following a return decision as ‘return’ (not ‘forced return’). In order to avoid confusion with the return of migrants based on their free will and without any direction from the State, the EMN has named ‘return’ when occurring in compliance with a return decision, ‘forced return’. 3. If the term ‘forced return’ is used in the European Union environment (e.g. in the metadata of Eurostat), it is understood as synonymous with ‘removal’ -i.e. the physical transportation out of the country following a return decision. 4. Outside of European Union legislation the term ‘forced return’ is more commonly used and understood as a return which occurs once a return decision has been issued. EMN ASYLUM AND MIGRATION GLOSSARY 10.0 263 U V W X Y Z
forced return monitoring BG наблюдение на принудителното връщане CS monitoring nucených návratů Definition(s) ES Control y seguimiento retorno forzoso All monitoring activities undertaken in respect of removal from the territory of an EU/EFTA Member State of a third-country national ordered to leave the country (from the preparation of departure, until reception in the country of return or in the case of failed removal until return to the point of departure). ET sunniviisilise tagasisaatmise jälgimine Source(s) DE Überwachung von Zwangsrückführungen EL παρακολούθηση αναγκαστικών επιστροφών EN forced return monitoring FI pakkopalautusten valvonta FR contrôle du retour forcé GA HR promatranje prislinog udaljenja HU kötelező visszatérés nyomon követése IT (sistema di) monitoraggio dei rimpatri forzati LT priverstinio grąžinimo stebėsena (EU acquis); išsiuntimo stebėsena LV piespiedu atgriešanas uzraudzība (EU acquis); piespiedu izraidīšanas uzraudzība MT Monitoraġġ tar-ritorn ta’ bilfors / tar-ripatrijazzjoni obbligatorja NL monitoring van gedwongen terugkeer PL monitorowanie/monitoring powrotów przymusowych PT monitorização do retorno forçado RO monitorizarea returnării forțate SK monitorovanie núteného návratu SL spremljanje prisilnega vračanja SV övervakning av återvändande med tvång NO Overvåking av tvangsretur KA იძულებითი დაბრუნების მონიტორინგი UK моніторинг примусового повернення HY 264 հարկադիր վերադարձի գնահատում Derived by EMN from Art. 8(6) of Directive 2008/115/EC (Return Directive) and Annex I to Commission Recommendation C(2017) 6505: Return Handbook Synonym(s) forced return monitoring system forced return monitoring tool return monitoring Broader term(s) forced return removal Euro Voc Classification 2811 migration Note(s) 1. Art. 8(6) of Directive 2008/115/EC (Return Directive) introduced an important fundamental rights safeguard for third-country nationals ordered to leave the EU obliging EU Member States to implement a forced return monitoring system. This should include involvement of organisations/bodies different and independent from the authorities enforcing return. The European Border and Coast Guard Agency (Frontex) supports return monitoring by deploying experts (‹return monitors›) who carry out independent monitoring of return operations to ensure compliance with fundamental rights (Art. 29 of Regulation (EU) 2016/1624 (European Border and Coast Guard Regulation)). 2. The mere existence of judicial remedies in individual cases or national systems of the supervision of the efficiency of national return policies cannot be considered as a valid application of Art. 8(6) of the Return Directive. 3. Art. 8(6) of the Return Directive does not imply a subjective right of a returnee to be monitored nor does it imply an obligation to monitor each single removal operation. A monitoring system based on spot checks and monitoring of random samples may be considered sufficient as long as the monitoring intensity is sufficiently close to guarantee overall efficiency of monitoring. 4. The monitoring does not cover post-return monitoring (the period following reception of the returnee in a third country). EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B foreign population of a country BG чуждестранно население на една държава C D Definition(s) CS populace cizinců v zemi All persons who have a certain country as their country of usual residence and who are citizens of another country. DE ausländische Bevölkerung eines Landes EL αλλοδαπός πληθυσμός σε μια χώρα Source(s) EN foreign population of a country OECD Glossary of Statistical Terms ES población extranjera H stock of foreigners FI maan ulkomainen väestö Related term(s) FR population étrangère d’un pays I migrant stock GA daonra eachtrannach tíre EMN Asylum and Migration Classification HR osobe stranog državljanstva u državi HU egy ország külföldi népessége IT popolazione straniera di un paese LT šalyje gyvenantys užsieniečiai F G Narrower term(s) ET välisriigi kodanikest rahvastik E 1. Framework Concepts on Migration (including root causes of migration J Euro Voc Classification K 2811 migration L LV ārzemnieki MT Popolazzjoni barranija ta’ pajjiż M NL bevolking van buitenlandse nationaliteit PL populacja cudzoziemców z kraju N PT população estrangeira RO populație străină a unei țări O SK populácia cudzincov v krajine SL tuje prebivalstvo države P SV utländska medborgare NO et lands utenlandske befolkning (b); den utanlandske folkesetnaden i eit land (n) Q KA ქვეყნის უცხოელი მოსახლეობა R UK іноземне населення країни HY S երկրի օտարերկրյա բնակչություն T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 265
fraudulent travel or identity document BG подправен документ за пътуване или самоличност CS padělaný nebo pozměněný cestovní doklad nebo doklad totožnosti DE gefälschtes Reise-oder Identitätsdokument / betrügerisches Reise-oder Identitätsdokument EL πλαστό έγγραφο ταυτότητας ή ταξιδιωτικό έγγραφο EN fraudulent travel or identity document ES documento de identidad o de viaje fraudulento ET võltsitud reisi- või isikut tõendav dokument FI väärä tai väärennetty matkustusasiakirja/ henkilötodistus FR document de voyage ou d’identité frauduleux GA bréagdhoiciméad taistil nó aitheantais HR krivotvorena putna ili identifikacijska isprava HU hamis úti vagy személyazonosságot igazoló okmány IT documento di viaggio o di identità fraudolento LT suklastotas kelionės ar asmens dokumentas LV viltots ceļošanas vai personu apliecinošs dokuments MT Dokument tal-ivjaġġar jew tal-identità frodulenti / qarrieqi NL frauduleus reis- of identiteitsdocument PL fałszywy dokument podróży lub tożsamości PT documento de viagem ou de identidade fraudulento RO document de călătorie sau de identitate fraudulos SK falošný alebo pozmenený cestovný alebo identifikačný doklad / falošný alebo pozmenený cestovný doklad alebo doklad totožnosti Definition(s) Any travel or identity document: (i) that has been falsely made or altered in some material way by anyone other than a person or agency lawfully authorised to make or issue the travel or identity document on behalf of a State; or (ii) that has been improperly issued or obtained through misrepresentation, corruption or duress or in any other unlawful manner; or (iii) that is being used by a person other than the rightful holder. Source(s) Art. 3(c) of Protocol against the Smuggling of Migrants by Land, Sea and Air, supplementing the UN Convention against Transnational Organised Crime Synonym(s) fraudulent travel document fraudulent identity document false travel document false identity document forged travel document forged identity document Related term(s) travel document EMN Asylum and Migration Classification 13.3 Crimes related to migration Euro Voc Classification 2811 migration SL ponarejena potna listina ali osebni dokument SV falsk rese- eller identitetshandling NO falskt reise- eller identitetsbevis KA ყალბი სამგზავრო ან პირადობის დამადასტურებელი დოკუმენტი UK підроблений проїзний документ або підроблений документ, що посвідчує особу HY 266 կեղծ ինքնության փաստաթուղթ կամ ճամփորդական փաստաթուղթ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B frontier worker C BG пограничен работник D Definition(s) CS přeshraniční pracovník DE Grenzarbeitnehmer EL διασυνοριακός εργαζόμενος / μεθοριακός εργαζόμενος EN frontier worker ES trabajador transfronterizo In the EU context, a worker who is employed in the frontier zone of an EU Member State but who returns each day or at least once a week to the frontier zone of a neighbouring country in which they reside and of which they are nationals. Source(s) ET piiriala töötaja Council Resolution of 20 June 1994 on limitation on admission of third-country nationals to the territory of the Member States for employment FI rajatyöntekijä FR travailleur frontalier Related term(s) GA oibrí trasteorann border resident cross-border worker local border traffic HR pogranični radnik HU határmenti ingázó munkavállaló IT lavoratore straniero frontaliero LV pierobežu darbinieks NL grensarbeider Euro Voc Classification PL pracownik przygraniczny PT trabalhador fronteiriço RO lucrător transfrontalier SK pracovník z prihraničnej oblasti SL obmejni delavec SV gränsarbetare NO arbeidstaker som grensependler (b); arbeidstakar som grensependlar (n) H I L M 2811 migration N Note(s) O 1. The definition covers in particular third-country nationals entering the European Union from the neighbouring third-country in which they reside. 2. Contrary to ‘cross-border workers’, frontier workers work in the frontier zone of the neighbouring country. KA საზღვრისპირა მუშაკი P Q R UK прикордонний працівник HY G K 3.1 Migration for Economic Purposes| 14.2 Economic factors and impacts (such as brain drain/gain, employment/ unemployment, labour market, economic growth, dumping) MT Ħaddiem ta’ mal-fruntiera F J EMN Asylum and Migration Classification LT pasienio darbuotojas E S առաջագծի աշխատող T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 267
fundamental rights BG основни права CS základní práva DE Grundrechte EL θεμελιώδη δικαιώματα EN fundamental rights ES Derechos fundamentales ET põhiõigused FI perusoikeudet Definition(s) Universal legal guarantees without which individuals and groups cannot secure their fundamental freedoms and human dignity and which apply equally to every human being regardless of nationality, place of residence, sex, national or ethnic origin, colour, religion, language, or any other status as per the legal system of a country without any conditions. Source(s) HR temeljna prava Derived by EMN from the Website of the European Commission on the EU Charter of Fundamental Rights and the FRA-Website HU alapvető jogok Related term(s) FR droits fondamentaux GA Cearta bunúsacha IT diritti fondamentali MT Drittijiet fundamentali Charter of Fundamental Rights of the European Union European Union Agency for Fundamental Rights (FRA) human rights European Convention on Human Rights (ECHR) NL fundamentele rechten Euro Voc Classification LT pagrindinės teisės LV pamattiesības PL prawa podstawowe PT direitos fundamentais RO drepturi fundamentale SK základné práva SL temeljne pravice SV grundläggande rättigheter NO grunnleggende rettigheter (b); grunnleggande rettar (n) KA ძირითადი უფლებები UK основні права HY 268 հիմնական իրավունքներ 1236 rights and freedoms Note(s) 1. Fundamental rights permit people to develop their full potential and their fundamental mental, psychological, intellectual and physical capacity. They define what individuals or groups of people are entitled to and describe the limitations a state may impose to intrude on those entitlements. Some rights are absolute and others non-derogable, while some rights are qualified. 2. An absolute right cannot be limited or infringed under any circumstances, not even during a declared state of emergency, such as Art. 3 of the European Convention on Human Rights (ECHR) and Art. 2 of the United Nations Convention against Torture (UNCAT). 3. Non-derogable rights may be either absolute or non-absolute. While non-derogable rights cannot be suspended, some provide for limitations in their ordinary application, such as the right to marry and found a family in Art. 12 of the ECHR. 4. Qualified rights permit interferences subject to various conditions but these must be in accordance with the law and necessary in a democratic state for the requirements of public order, public health or morals, national security or public safety, such as the right to freedom of expression (Art. 10 of the ECHR). 5. There are many crossovers between human rights and fundamental rights. According to the European Union Agency for Fundamental Rights (FRA), both fundamental rights and human rights entitle individuals to expect and receive certain levels of treatment. However, there is a difference: the term ‘fundamental rights’ is specifically used in national constitutions, whereas ‘human rights’ is used in international law. 6. In the European Union, fundamental rights are guaranteed nationally by the constitutions of the EU Member States and at EU level by the Charter of Fundamental Rights of the European Union. The personal scope of application of the Charter is potentially 7. The European Union Agency for Fundamental Rights is the EU’s centre of fundamental rights expertise, for further information see the Website of FRA EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B gender BG социален пол CS gender DE soziales Geschlecht EL φύλο EN gender ES género C D Definition(s) The socially constructed attributes, roles, activities, responsibilities and needs predominantly connected to being male or female in given societies or communities at a given time. E Source(s) G ET sugu Derived by EMN from the list of Concepts and Definitions on the UN Women website FI sukupuoli Related term(s) FR genre IT genere LGB(TI) sex sexual orientation social group gender identity LT lytis EMN Asylum and Migration Classification GA inscne HR rod HU gender / társadalmi nem LV dzimums MT Ġeneru / Ġens / Sess NL gender PL gender, płeć społeczno-kulturowa PT género RO gen SK rod SL spol SV genus NO kjønn KA გენდერი UK гендер HY սեռ F H I J K 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) L Euro Voc Classification M 28 Social Questions N Note(s) 1. People fleeing human rights violations and persecution due to their sexual orientation and/or gender identity may qualify for international protection. Directive 2011/95/EU (Recast Qualification Directive) refers in Art. 10 ‘Reasons for persecution’ to gender related aspects, including gender identity, which shall be given due consideration for the purposes of determining membership of a particular social group or identifying a characteristic of such a group. 2. The United Nations High Commissioner for Refugees (UNHCR) and the European Union Agency for Asylum (EUAA) use the following definition of ‘gender identity’: ‘”Each person’s deeply felt internal and individual experience of gender, which may or may not correspond with the sex assigned at birth, including the personal sense of the body - which may involve, if chosen, modification of bodily appearance or function by medical, surgical or other means - and other expressions of gender, including of dress, speech and mannerism (see ICJ, Yogyakarta Principles - Principles on the Application of International Human Rights Law in relation to Sexual Orientation and Gender Identity, (‘Yogyakarta Principles’), March 2007 . O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 269
gender identity BG полова идентичност CS genderová identita DE Geschlechtsidentität EL ταυτότητα φύλου EN gender identity ES dentidad de género ET sooidentiteet/ sooline identiteet FI sukupuoli-identiteetti FR identité de genre GA féiniúlacht inscne HR rodni identitet HU nemi identitás IT identità di genere LT lytinė tapatybė Definition(s) Each person’s deeply felt internal and individual experience of gender, which may or may not correspond with the sex assigned at birth, including the personal sense of the body (which may involve, if freely chosen, modifications of bodily appearance or function by medical, surgical or other means) and other expressions of gender, including dress, speech and mannerism. Source(s) Yogyakarta principles on the application of international human rights law in relation to sexual orientation and gender identity, March 2006 Related term(s) sexual orientation EMN Asylum and Migration Classification LV dzimumidentitāte 1. Framework Concepts on Migration (including root causes of migration| 7. Vulnerable Groups MT Identità tal-ġeneru Euro Voc Classification NL genderidentiteit PL tożsamość płciowa PT identidade de género RO identitate de gen SK rodová identifikácia / rodová identita SL spolna identiteta SV könsidentitet NO kjønnsidentitet KA გენდერული იდენტობა UK гендерна ідентичність HY 270 սեռային ինքնությունը 1236 rights and freedoms Note(s) 1. The Yogyakarta Principles, adopted in 2006, are a set of principles on the application of international human rights law in relation to sexual orientation and gender identity. Principle 23 includes the right to asylum. 2. In 2017 a set of new principles on international human rights law relating to sexual orientation, gender identity, gender expression and sex characteristics (SOGIESC) were added, among others the right to state protection: “Everyone, regardless of sexual orientation, gender identity, gender expression or sex characteristics, has the right to State protection from violence, discrimination and other harm, whether by government officials or by any individual or group”. For more in-formation see: The Yogyakarta Principles plus 10 (YP+10), 2017. 3. Gender identity can be a ground for protection under the Geneva Refugee Convention and Protocol and under EU international protection legislation. 4. Art. 10 of Directive 2011/95/EU (Recast Qualification Directive) explicitly includes sexual orientation and gender identity among the possible reasons for persecution, both should be given due consideration when determining whether a person belongs to a particular social group under persecution. 5. According to Art.18(3) of Directive 2013/33/EU (Recast Reception Conditions Directive) EU Member States must take into consideration gender concerns and the specific needs of vulnerable persons such as LGBTI people within the premises and accommodation centres. Additionally, they are required to take appropriate measures to prevent assault and gender-based violence, including sexual assault and harassment into considerations in reception. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B gender-based persecution BG преследване, основано на пола C D Definition(s) CS pronásledování na základě genderové příslušnosti DE Verfolgung aufgrund des Geschlechts / geschlechtsspezifische Verfolgung EL δίωξη λόγω φύλου Persecution that targets or disproportionately affects a particular gender. E Source(s) F FI sukupuoleen perustuva vaino Derived by EMN from UNHCR Master Glossary of Terms and UNHCR: Guidelines on international protection: Genderrelated persecution within the context of Article 1A(2) of the 1951 Convention and/or its 1967 Protocol relating to the Status of Regfuees, May 2002. FR persécution fondée sur le genre Synonym(s) EN gender-based persecution ES Persecución por razón de género ET sooline tagakiusamine GA géarleanúint ar bhonn inscne HR rodno utemeljen progon gender-related persecution gender-specific persecution HU nemi hovatartozáson alapuló üldöztetés G H I J Narrower term(s) IT persecuzione fondata su ragioni di genere gender-specific violence K LT persekiojimas lyties pagrindu Related term(s) L female genital mutilation gender social group LV dzimumspecifiska vajāšana MT Persekuzzjoni marbuta mal-ġeneru NL gendergerelateerde vervolging PL prześladowanie ze względu na płeć RO persecuție pe bază de gen / persecuție bazată pe gen SL preganjanje na podlagi spola SV könsrelaterad förföljelse NO kjønnsbasert forfolgelse (b); kjønnsbasert forfølging (n) KA გენდერული ნიშნით დევნა UK переслідування за гендерною ознакою HY սեռի պատճառով հալածանք EMN Asylum and Migration Classification N Euro Voc Classification O 4.1.1 Refugee protection PT perseguição baseada no género SK prenasledovanie z dôvodu rodovej príslušnosti M 1231 international law| 2811 migration P Note(s) 1. Gender-based persecution is a term that has no legal meaning per se. It is used to encompass the range of different claims in which gender is a relevant consideration in the determination of refugee status.Typically, gender-related persecution encompasses, but is not limited to, acts of sexual violence, family/domestic violence, coerced family planning, female genital mutilation and other harmful traditional practices, punishment for transgression of social mores, and discrimination on account of someone›s sexual orientation or gender identity. Gender-related claims may be brought by either women or men, although they are more commonly brought by women. 2. Although gender is not specifically referenced as one of the grounds on which an individual can be recognized as a refugee and given protection, it is widely accepted that it can influence or dictate the reasons for persecution and as such there is no need to add an additional ground to the Refugee Convention definition. A gender-sensitive interpretation should be given to each of the Convention grounds ‘race, religion, nationality, membership of a particular social group or political opinion› although gender-based persecution is predominantly interpreted within the parameters of the particular social group ground. Gender-based persecution is a term that has no legal meaning per se. It is used to encompass the range of different claims in which gender is a relevant consideration in the determination of refugee status. Gender-related claims may be brought by either women or men, although they are more commonly brought by women Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 271
gender-specific violence BG Насилие свързано с полова принадлежност CS násilí na základě genderové příslušnosti DE geschlechtsspezifische Gewalt EL έμφυλη βία EN gender-specific violence ES Violencia de género ET soopõhine vägivald FI sukupuolistunut väkivalta FR violence liée au genre GA foréigean dírithe ar inscne HR rodno uvjetovano nasilje HU nemi hovatartozáshoz kapcsolódó erőszak IT violenza di genere LT smurtas lyties pagrindu LV dzimumspecifiska vardarbība MT Vjolenza marbuta mal-ġeneru Definition(s) Different types and forms of harm and human right violations which are gender-specific but which do not necessarily constitute persecution because of gender. Source(s) Crawley, Heaven: Gender-Related Persecution and Women’s Claims to Asylum, 2004. Synonym(s) GBV gender-based violence gender-specific harm Broader term(s) gender-based persecution Related term(s) female genital mutilation EMN Asylum and Migration Classification NL gendergerelateerd geweld 4. International Protection and other Types of Protection| 7. Vulnerable Groups PL przemoc uwarunkowana płcią Euro Voc Classification PT violência específica de género RO violență de gen SK rodovo podmienené násilie / rodovo motivované násilie SL nasilje, vezano na spol SV könsspecifikt våld NO kjønnsbasert vold (b); kjønnsbasert vald (n) KA კონკრეტულ გენდერთან დაკავშირებული ძალადობა 28 Social Questions Note(s) 1.There are different forms of gender-specific violence such as sexual violence, rape, female genital mutilation, domestic abuse, forced abortion and sterilization, and denial of access to contraception, certain forms of which are more frequently used against women or affect women in a manner which is different to men. 2. The Recast Qualification Directive (Directive 2011/95/EU) recognises that gender-specific acts may amount to persecution. 3. Gender-specific violence is understood as a narrower term to gender-based persecution. UK гендерно обумовлене насильство HY 272 սեռով պայմանավորված բռնություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
General Directors’ Immigration Services Conference (GDISC) BG Конференция на генералните директори на имиграционните служби A B C D Definition(s) E An informal network established in order to facilitate practical cooperation in the field of asylum and migration between the General Directors of Immigration Services of the different member countries. CS Konference generálních ředitelů imigračních služeb DE Konferenz der Generaldirektoren der Einwanderungsbehörden EL Διάσκεψη των Γενικών Διευθυντών των Υπηρεσιών Μετανάστευσης F G Source(s) Derived by the EMN from the website of GDISC EN General Directors’ Immigration Services Conference (GDISC) ES Conferencia de Directores Generales de los Servicios de Inmigración ET sisserändeteenistuste peadirektorite konverents H Synonym(s) GDISC I Related term(s) European Union Agency for Asylum (EUAA) FI Maahanmuuttovirastojen johtajien konferenssi J EMN Asylum and Migration Classification FR Conférence des directeurs généraux des services d’immigration 15.1 EU External dimension of migration and mobility GA Comhdháil Stiúrthóirí Ginearálta na Seirbhísí Inimirce HR Konferencija glavnih direktora imigracijskih službi (GDISC) HU Bevándorlási Hatóságok Főigazgatóinak Konferenciája K Euro Voc Classification 10 European Union L Note(s) M 1. The GDISC was initiated in 2004. 2. Member countries comprise the 27 EU Member States, CH, IC, NO and the UK, Bosnia and Herzegovina, North Macedonia and Turkey. 3. For more information, see the website of GDISC IT Conferenza dei Direttori generali dei Servizi immigrazione N LT Imigracijos tarnybų generalinių direktorių konferencija O LV Imigrācijas dienestu ģenerāldirektoru konference (GDISC) P MT Konferenza (Il-) tad-Diretturi Ġenerali tas-Servizzi tal-Immigrazzjoni Q NL Conferentie van algemeen directeuren van de immigratiediensten R PL Konferencja Dyrektorów Generalnych Służb Imigracyjnych S PT Conferência dos Diretores-gerais dos Serviços de Imigração T RO Conferinţa Directorilor Generali ai Serviciilor de Imigrare U SK Konferencia generálnych riaditeľov imigračných služieb (GDISC) V SL Konferenca generalnih direktorjev služb za priseljevanje SV GDISC-konferensen / GDISC W NO GDISC-konferansen / The General Directors’ Immigration Services Conference X KA საიმიგრაციო სამსახურების გენერალურ Y დირექტორთა კონფერენცია (GDISC) UK Конференція генеральних директорів імміграційних служб (GDISC) HY Z Ներգաղթի ծառայությունների գլխավոր տնօրենների համաժողով EMN ASYLUM AND MIGRATION GLOSSARY 10.0 273
Geneva Refugee Convention and Protocol BG Женевска конвенция за статута на бежанците от 1951 г. и Протокол от 1967 г. CS Ženevská úmluva o uprchlících a Protokol DE Genfer Flüchtlingskonvention und Protokoll / Übereinkommen über die Rechtsstellung von Flüchtlingen / Flüchtlingsabkommen EL Σύμβαση της Γενεύης και Πρωτόκολλο EN Geneva Refugee Convention and Protocol ES Convenio de Ginebra de 1951 y Protocolo de 1967 ET Genfi pagulasseisundi konventsioon ja protokoll FI Geneven yleissopimus ja sen lisäpöytäkirja FR Convention de Genève et Protocole relatifs au statut des réfugiés GA Coinbhinsiún na Ginéive (1951) agus Prótacal na Ginéive (1967) HR Ženevska konvencija i protokol o statusu izbjeglica Definition(s) The UN multilateral treaty which is the key legal document defining who is a refugee and who is not, the rights of refugees and the legal obligations of States towards them. Source(s) Geneva Refugee Convention and Protocol Synonym(s) Convention relating to the Status of Refugees Geneva Convention of 1951 and Protocol of 1967 Geneva Refugee Convention and New York Protocol 1951 Refugee Convention 1951 Convention Relating to the Status of Refugees and the 1967 Protocol Relating to the Status of Refugees 1951 Geneva Convention Refugee Convention HU a menekültek helyzetére vonatkozó Genfi Egyezmény és Jegyzőkönyv Broader term(s) IT Convenzione di Ginevra e Protocollo di New York sullo status dei Rifugiati Narrower term(s) LT Ženevos konvencija dėl pabėgėlių statuso ir protokolas LV Ženēvas Konvencija par bēgļa statusu un Protokols par bēgļa statusu MT Konvenzjoni (Il-) ta’ Ġinevra u l-Protokol dwar ir-Refuġjati NL Geneefse Conventie en Protocol / Verdrag van Genève en Protocol / Vluchtelingenverdrag PL Konwencja Genewska z 1951 r. i Protokół z 1967 r. PT Convenção de Genebra e Protocolo RO Convenţia de la Geneva şi Protocolul SK Ženevský dohovor a protokol / Dohovor o právnom postavení utečencov a Newyorský protokol SL Ženevska konvencija o beguncih in Protokol SV Genèvekonventionen om flyktingars rättsliga ställning och dess tilläggsprotokoll NO Geneve konvensjonen og protokollen om flyktninger / Genevekonvensjonen og Geneveprotokollen KA ლტოლვილთა შესახებ ჟენევის კონვენცია და refugee law Convention grounds for persecution Convention refugee refugee Related term(s) international protection United Nations High Commissioner for Refugees (UNHCR) Euro Voc Classification 1231 international law Note(s) 1. The 1951 Refugee Convention was approved at a special United Nations conference on 28 July 1951 and consolidates previous international instruments relating to refugees. It provides the most comprehensive codification of the rights of refugees at international level. In contrast to earlier international refugee instruments, which applied to specific groups of refugees, the 1951 Convention endorses a single definition of the term ‘refugee’ in Art. 1. 2. The Convention is both a status and rights-based instrument and is underpinned by a number of fundamental principles, most notably non-discrimination, non-penalisation and non-refoulement. 3. The 1967 New York Protocol removed geographical and temporal restrictions from the Convention. ოქმი UK Конвенція про статус біженців 1951 року та Протокол щодо статусу біженців 1967 року HY 274 Ժնևի փախստականի կոնվենցիա և արձանագրություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B genocide BG геноцид CS genocida C D Definition(s) DE Völkermord An act committed with intent to destroy, in whole or in part, a national, ethnical, racial or religious group. E EL γενοκτονία Source(s) F EN genocide ES genocidio ET genotsiid FI joukkotuhonta/kansanmurha FR génocide GA cinedhíothú HR genocid HU népirtás IT genocidio Art. 2 of the UN Convention on the Prevention and Punishment of the Crime of Genocide of 1948 G Related term(s) crime against humanity ethnic cleansing H EMN Asylum and Migration Classification I 1. Framework Concepts on Migration (including root causes of migration J Euro Voc Classification 1231 international law K Note(s) L LT genocidas LV genocīds MT Ġenoċidju NL genocide / volkerenmoord PL ludobójstwo PT genocídio RO genocid SK genocída 1. As outlined in the Convention, these acts include: (a) killing members of the group; (b) causing serious bodily or mental harm to members of the group; (c) deliberately inflicting on the group conditions of life calculated to bring about its physical destruction in whole or in part; (d) imposing measures intended to prevent births within the group; (e) forcibly transferring children of the group to another group. 2. The definition is also outlined in Art. 6 of the Rome Statute of the International Criminal Court. SL genocid N O P SV folkmord NO folkemord Q KA გენოციდი R UK геноцид HY M ցեղասպանություն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 275
Global Approach to Migration and Mobility (GAMM) BG Глобален подход към миграцията и мобилността CS Globální přístup k migraci a mobilitě DE Gesamtansatz für Migration und Mobilität (GAMM) EL Συνολική Προσέγγιση της Μετανάστευσης και της Κινητικότητας (ΣΠΜΚ) EN Global Approach to Migration and Mobility (GAMM) ES Enfoque Global de la Migración Definition(s) The overarching framework of the European Union’s external migration policy based on genuine partnership with non-EU countries and addressing all aspects of migration and mobility issues in an integrated, comprehensive and balanced manner. Source(s) ET globaalne lähenemine rändele ja rahvastiku liikuvusele European Commission: Communication on the Global Approach to Migration and Mobility, COM(2011) 743 final FI Maahanmuuttoa ja liikkuvuutta koskeva kokonaisvaltainen lähestymistapa (GAMM) Synonym(s) FR approche globale de la question des migrations et de la mobilité (AGMM) GA Cur Chuige Domhanda i leith Imirce agus Soghluaisteachta GAMM Global Approach to Migration GAM Narrower term(s) NL totaalaanpak van migratie en mobiliteit Africa-EU Migration, Mobility and Employment Partnership Budapest Process Cotonou Agreement Dialogue on Mediterranean Transit Migration Eastern Partnership (EAP) Khartoum Process Prague Process PL Globalne Podejście do Migracji i Mobilności Related term(s) HR Globalni pristup migracijama i mobilnosti (GAMM) HU a migráció és mobilitás globális megközelítése IT Approccio globale in materia di migrazione e mobilità LT Visuotinis požiūris į migraciją ir mobilumą LV Vispārēja pieeja migrācijai un mobilitātei MT Approċċ Globali għall-Migrazzjoni u l-Mobilità SK Globálny prístup k migrácii a mobilite (GPMM) external dimension of EU migration and asylum policy mobility partnership readmission agreement Rabat Process SL globalni pristop k vprašanju migracij in mobilnosti EMN Asylum and Migration Classification PT Abordagem Global da Migração e Mobilidade RO Abordarea Globală în materie de Migraţie şi Mobilitate (GAMM) SV den övergripande strategin för migration och rörlighet / GAMM 15.1 EU External dimension of migration and mobility NO global tilnærming til migrasjon og mobilitet (GAMM) 10 European Union Euro Voc Classification KA გლობალური მიდგომა მიგრაციისა და მობილობისადმი (GAMM) UK Глобальний підхід до міграції та мобільності (GAMM) HY 276 Միգրացիայի և Շարժունակության համաշխարհային մոտեցում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. The Global Approach to Migration (GAM) was first defined by the European Council in December 2005 (COM(2007) 247) and further developed in 2007 and 2008. It has constituted the framework for the cooperation of the EU with third countries in the area of migration and asylum. The Stockholm Programme adopted in 2009 also acknowledged the importance of consolidating, strengthening and implementing the GAM. 2. The approach comprises the whole migration agenda, including legal and irregular migration, combating trafficking in human beings and smuggling of migrants, strengthening protection for refugees, enhancing migrant rights and harnessing the positive links that exist between migration and development. 3. In 2011, the global approach was evaluated. As a result of this, the Commission highlighted the need for further strengthening the external migration policy and published in November 2011 the Communication on the Global Approach to Migration and Mobility, COM(2011) 743 final on a new impetus to the EU’s external migration policy. The renewed GAMM focuses on four main priorities: improving the organisation of legal migration and facilitated mobility, preventing and reducing irregular migration in an efficient, yet humane way, strengthening the synergies between migration and development, and strengthening international protection systems and the external dimension of asylum. 4. The European Agenda for Migration 2015 and the New Pact on Migration and Asylum 2020 further strenghtened the external dimension of the EU migration and asylum policy by building on current EU migration partnership frameworks while at the same time reinforcing them through ‘tailor-made partnerships’ with third countries with a view to ensuring effective returns, combating irregular migration and smuggling of migrants more effectively, and developing legal migration channels. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 277
Global Forum on Migration and Development (GFMD) BG Глобален форум за миграция и мобилност CS Globální fórum k migraci a rozvoji DE Weltforum über Migration und Entwicklung EL Παγκόσμιο Φόρουμ για τηνΜετανάστευση και την Ανάπτυξη EN Global Forum on Migration and Development (GFMD) ES Foro Mundial sobre Migración y Desarrollo Definition(s) An initiative of the UN Member States to address the migration and development interconnections in practical and action-orientated ways. Source(s) Website of the Global Forum on Migration and Development ET ülemaailmne rände-ja arengupoliitika foorum Synonym(s) FI Muuttoliikettä ja kehitystä käsittelevä maailmanlaajuinen foorumi Related term(s) GFMD HU a Migráció és Fejlesztés Globális Fóruma Cooperation Platform on Migration and Development Cotonou Agreement Dialogue on Mediterranean Transit Migration Global Approach to Migration and Mobility (GAMM) migration profile IT Forum Globale su Migrazione e Sviluppo Euro Voc Classification FR Forum mondial sur la migration et le développement (FMMD) GA Fóram Domhanda maidir le hImirce agus Forbairt HR Globalni forum za migracije i razvoj (GFMD) LT Pasaulinis migracijos ir vystymosi forumas LV Pasaules forums par migrāciju un attīstību MT Forum Globali fuq Migrazzjoni u Żvilupp NL Wereldforum voor migratie en ontwikkeling PL Światowe Forum na Rzecz. Migracji i Rozwoju PT Fórum Global sobre Migrações e Desenvolvimento RO Forumul Glrobal cu privire la Migraţie şi Dezvoltare 04 Politics Note(s) 1. The first session of the GFMD was held in 2007. 2. The GFMD is a voluntary, informal, non-binding and government-led process open to all States and Observers of the UN, to advance understanding and cooperation on the mutually reinforcing relationship between migration and development. 3. For more information, see the website of GFMD. SK Globálne fórum o migrácii a rozvoji (GFMD) SL Globalni forum o migracijah in razvoju SV Globalt forum för migration och utveckling NO Globalt forum for migrasjon og utvikling KA მიგრაციისა და განვითარების გლობალური ფორუმი (GFMD) UK Глобальний форум з міграції та розвитку (GFMD) HY 278 Միգրացիայի և զարգացման գլոբալ ֆորում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
group determination of refugee status BG групово определяне на статут на бежанец CS skupinové určení statusu uprchlíka EL ομαδικός καθορισμός του καθεστώτος του πρόσφυγα EN group determination of refugee status ES determinación colectiva de la condición de refugiado FI pakolaisaseman ryhmämäärittäminen FR détermination collective du statut de réfugié GA stádas dídeanaí a chinneadh ar bhun grúpa HR grupno utvrđivanje izbjegličkog statusa B C D Definition(s) DE Gruppenfeststellung der Flüchtlingseigenschaft ET grupi pagulasseisundi kindlaksmääramine A A practice by which all persons forming part of a largescale influx are regarded as refugees on a prima facie basis, ensuring that protection and assistance needs are met without prior individual determination of refugee status. Source(s) UNHCR Master Glossary of Terms E F G H Synonym(s) prima facie determination of refugee status I Related term(s) HU menekültként való csoportos elismerés group persecution prima facie refugee J IT riconoscimento collettivo dello status di rifugiato EMN Asylum and Migration Classification LT pabėgėlio statusas (suteikiamas grupei) 4.1.1 Refugee protection K LV bēgļa statusa noteikšana grupai Euro Voc Classification L MT Għarfien kollettiv tal-istatus ta’ rifuġjat 1231 international law| 2811 migration NL vaststelling van prima facie vluchtelingschap / vaststelling van vluchtelingenstatuut zonder meer Note(s) PL grupowe uznanie statusu uchodźcy PT determinação colectiva do estatuto de refugiado (refugiados prima facie) RO determinare în grup a statutului de refugiat SK skupinové určenie štatútu utečenca SL skupinsko določanje statusa begunca SV gruppbestämning av flyktingstatus M Refugee status must normally be determined on an individual basis, but when large populations are displaced under circumstances that indicate that most members of the population could individually be considered refugees, and where the need to provide protection and assistance is urgent and / or where it may not be possible for practical reasons to carry out an individual determination of refugee status, each member of that population in question can be regarded prima facie (in the absence of evidence to the contrary) as a refugee. In other words, the presumption is that individual members of the population concerned would be considered as refugees in need of protection. For more information, see UNHCR: Refugee status determination 2005. NO gruppeavgjørelse av flyktningstatus (b); gruppeavgjerd av flyktningestatus (n) O P Q R KA ლტოლვილის სტატუსის ჯგუფური დადგენა S UK групове визначення статусу біженця HY N փախստականի կարգավիճակի խմբային որոշում T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 279
group persecution BG групово преследване CS pronásledování skupiny Definition(s) HR proganjanje određene društvene skupine A concept - which recognises that persecution can be enacted against members of a section of the population (a ‹group›) that is suffering oppression or is threatened as a whole in its home country according to one of the criteria defined in the Geneva Refugee Convention and its Protocol - and which in any case, whilst a group may be persecuted, requires that an application for international protection must be examined on an individual basis in the EU Member States, and not all together as one group. HU csoportos üldöztetés Source(s) DE Gruppenverfolgung EL ομαδική δίωξη EN group persecution ES no translation ET grupi tagakiusamine FI ryhmään kohdistuva vaino FR persécution à l’encontre d’un groupe GA géarleanúint grúpa IT persecuzione di gruppo LT persekiojamoji grupė LV grupas vajāšana MT Persekuzzjoni ta’ grupp(-i) ta’ nies NL groepsvervolging PL grupowe prześladowanie Definition according to the consistent practice of the German Federal Administrative Court based on ruling of 15 May 1990 -9 C 17.89 Broader term(s) persecution Related term(s) SK prenasledovanie skupiny act of persecution actor of persecution or serious harm group determination of refugee status prima facie refugee SL skupinsko preganjanje EMN Asylum and Migration Classification PT grupo alvo de perseguição RO persecuţie de grup SV förföljelse av en grupp 2.4 National| 4.1.1 Refugee protection NO forfølgelse av en gruppes medlemmer (b); forfølging av medlemmene av ei gruppe (n) Euro Voc Classification 12 Law KA ჯგუფის დევნა UK групове переслідування HY 280 խմբային հալածանք Note(s) 1. An assumption of group persecution requires a certain intensity of persecution to warrant the general assumption of the individual persecution of each group member, irrespective of whether an individual has indeed been the victim of such persecution. This requires a threat emanating from so large a number of violations of rights protected by asylum law that it goes beyond separate individual infringements or a large number of individual infringements, but rather constitutes acts of persecution in the specific territory aimed at the group as a whole which increase, are repeated and spread to such an extent that there is not only a possibility, but a direct imminent danger of becoming a victim oneself for any member of such a group. 2. With consideration to the general principle of subsidiarity in refugee law, group persecution will only entitle a refugee to protection abroad, if the danger is present in the entire territory of the country of origin, i.e. if there is no internal alternative for protection. For the purposes of the danger of persecution after return, such an internal flight alternative must be reasonable and accessible from the country of refuge. 3. For more information on group persecution, see the European Database of Asylum Law (EDAL). , i.e. German Federal Administrative Court, ruling of 12 April 2009 -10 C 11.08. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 281
guardian BG попечител или настойник CS opatrovník DE Vormund; Obsorgeberechtigter (AT) EL επίτροπος (EL); κηδεμόνας (CY) EN guardian ES tutor ET eestkostja FI huoltaja FR tuteur; représentant légal (LU) GA caomhnóir HR skrbnik HU gyám IT tutore LT globėjas LV aizbildnis MT Kustodju / Tutur(-triċi) Definition(s) In the migration context, an independent person appointed to act on behalf of a child, in the absence of (both) parents or the adult responsible for the child by law or by practice, who safeguards the best interests of the child (BIC) and general well-being, and to this effect complements the limited legal capacity of the child, when necessary, in the same way that parents do. Source(s) Derived by EMN from Fundamental Rights Agency (FRA): Guardianship systems for children deprived of parental care in the European Union, Summary, 2018, and UN Committee on the Rights of the Child: General Comment No. 6 (2005):Treatment of unaccompanied and separated children outside their country of origin and IATE entry for guardian Synonym(s) NL voogd recognised responsible adult responsible adult PL opiekun Broader term(s) PT tutor SK poručník child unaccompanied minor separated child SL skrbnik Narrower term(s) RO tutore SV god man representative NO verge, representant (b); verje, representant (n) EMN Asylum and Migration Classification KA მეურვე/მზრუნველი 7.2 Minors and unaccompanied minors UK опікун (піклувальник) Euro Voc Classification HY 282 խնամակալ 2806 family| 2811 migration EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. Neither in the international context nor at EU or national level is there a uniform definition and use of the terms guardian and (legal) representative. Sometimes both terms are understood as synonyms. An overview of different terms used in international and EU context can be found in: Fundamental Rights Agency: Guardianship for children deprived of parental care, 2015. 2. The EMN Glossary puts the emphasis on the functions of the appointed person, rather than on the terminology. The term ‘guardian’ reflects the broader concept and goes beyond the responsibility of a (legal) representative. While a guardian has parental authority over a child, is in charge of all day-to-day life matters and acts as a link between the child and existing specialist agencies/individuals, a representative has a narrower mandate and is responsible for the legal representation of the child within particular legal or administrative proceedings. A guardian and a representative can be the same person, but do not necessarily have to be. The guardian differs also from a social worker or other caregivers responsible for the material needs of the child. For more information see Fundamental Rights Agency (FRA): Guardianship systems for children deprived of parental care in the European Union, Summary, 2018. 3. In the migration context, international and EU legislation recognise the importance of guardianship and legal representation to safeguard the child’s best interests and well-being. States should appoint a guardian as soon as an unaccompanied minor or separated child is identified and maintain such guardianship arrangements until the child has either reached the age of majority or has permanently left the territory and/or jurisdiction of the State or has been entrusted to the person exercising parental authority or guardianship. The guardian should be consulted and informed regarding all actions taken in relation to the child and have the authority to be present in all planning and decision-making processes, including immigration and appeal hearings, care arrangements and all efforts to search for a durable solution. The guardian should have the necessary expertise in the field of child care, so as to ensure that the interests of the child are safeguarded and that the child›s legal, social, health, psychological, material and educational needs are appropriately covered. If a guardian is unable to adequately represent the child›s best interests in all spheres and at all levels of the child›s life, supplementary measures (such as the appointment of a legal representative) must be secured. 4. In some EU Member States private organisations, state institutions or municipalities can be appointed as a guardian. 5. The inconsistent use of both terms in EU legislation can be seen e.g. in Art. 4(2f) of Amended Proposal for a Regulation establishing a common procedure for international protection in the Union and repealing Directive 2013/32/EU, COM/2020/611 final as it uses the term ‹guardian› with the previous definition of ‹representative› in Art. 2(n) of Directive 2013/32/EU (Recast Asylum Procedures Directive). F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 283
guest worker BG гост работник CS dočasně pracující cizinec / gastarbeiter Definition(s) DE Gastarbeiter An economic migrant recruited for a restricted time of settlement and employment. EL μετανάστης εργαζόμενος / επισκέπτης εργαζόμενος Source(s) EN guest worker Developed by EMN ES trabajador invitado Broader term(s) ET võõrtöötaja economic migrant FI vierastyöläinen Related term(s) FR travailleur invité / travailleur étranger migrant worker GA aoi-oibrí EMN Asylum and Migration Classification HR gostujući radnik 3.1 Migration for Economic Purposes HU vendégmunkás Euro Voc Classification IT lavoratore ospite LT besisvečiuojantis darbuotojas LV viesstrādnieks MT Ħaddiem mistieden 2811 migration Note(s) This term is no longer used in the EU context. It was more or less restricted to migration flows in the 1950s and 1960s. NL gastarbeider PL gastarbaiter PT trabalhador convidado RO lucrător invitat SK zahraničný hosťujúci pracovník SL gostujoči delavec SV gästarbetare NO gjestearbeider (b); gjestearbeidar (n) KA მოწვეული მუშაკი UK гастарбайтер HY 284 հրավիրյալ աշխատող EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B harassment BG тормоз CS obtěžování DE Belästigung EL παρενόχληση EN harassment ES acoso C Unwanted conduct related to racial or ethnic origin with the purpose or effect of violating the dignity of a person and of creating an intimidating, hostile, degrading, humiliating or offensive environment. E Source(s) G ET ahistamine Art. 2 (3) of Council Directive 2000/43/EC (Racial Equality Directive) FI häirintä EMN Asylum and Migration Classification FR harcèlement GA ciapadh 1. Framework Concepts on Migration (including root causes of migration HR uznemiravanje Euro Voc Classification HU zaklatás D Definition(s) H I J 12 Law IT molestia K LT priekabiavimas L LV uzmākšanās MT Molestja / Fastidju M NL intimidatie PL molestowanie N PT assédio RO hărţuire O SK obťažovanie SL nadlegovanje P SV trakasserier NO trakassering / mobbing Q KA შევიწროება R UK утиски HY F ոտնձգություն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 285
harmful onward movement BG no translation CS riskantní přesouvání Definition(s) DE gefährliche Weiterwanderung The movement of refugees and migrants by dangerous means from one location to another. EL επικίνδυνη δευτερογενής μετακίνηση Source(s) EN harmful onward movement ES movimientos irregulares peligrosos ET ohtlik (edasi) liikumine FI vaarallisin keinoin siirtyminen (uudistermi) FR mouvement secondaire dangereux GA athghluaiseacht dhainséarach HR opasno daljnje kretanje HU no usual translation IT spostamento pericoloso LT pavojingas judėjimas pirmyn LV bīstama pārvietošanās Derived by EMN from UNHCR: Draft Proposal for a Central Mediterranean Sea Initiative: EU solidarity for rescue-at-sea, protection and comprehensive responses, 2013 EMN Asylum and Migration Classification 1. Framework Concepts on Migration (including root causes of migration| 14. Factors and Impacts of Migration Euro Voc Classification 2811 migration Note(s) This term has only been recently put into use by practitioners. MT Spostament sekondarju dannuż / ta’ ħsara NL no translation PL niebezpieczne dalsze przemieszczanie się PT rotas perigosas RO mişcare de avansare periculoasă SK riskantné presúvanie sa utečencov a migrantov SL nevarno nadaljevanje poti SV farlig vidareförflyttning NO risikabel viderereise (b); risikabel vidarereise (n) KA საფრთხისშემცველი გადაადგილება UK небезпечне переміщення HY 286 վտանգավոր երկրորդային տեղաշարժ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B High-Level Network for Return BG Мрежа на високо равнище по въпросите на връщането CS Síť na vysoké úrovni pro návraty DE Hochrangiges Netzwerk für Rückkehrfragen EL Δίκτυο Υψηλού επιπέδου για τις Επιστροφές EN High-Level Network for Return ES Red de alto nivel para el retorno ET kõrgetasemeline tagasisaatmise võrgustik FI Palauttamisasioiden korkean tason verkosto C D Definition(s) Network to support the Return Coordinator with the coherent and consistent implementation of EU return policy by identifying priority activities to develop national frameworks, improve administrative and technical capacities to carry out returns, as well as enhancing cooperation between EU Member States and the European Border and Coast Guard Agency (Frontex). Source(s) E F G H I HR Mreža na visokoj razini za povratak Derived by EMN from EuropeanCommission: Communication on a New Pact on Migration and Asylum, COM(2020) 609 final and IATE HU Visszatéréssel Foglalkozó Magas Szintű Hálózat Synonym(s) K FR réseau de haut niveau pour les retours GA an Líonra Ardleibhéil um Fhilleadh IT Rete di alto livello per i rimpatri LT Aukšto lygio tinklas grąžinimo klausimais High Level Network on Return High-Level Network for Returns LV augsta līmeņa tīkls atgriešanas jautājumos Broader term(s) MT Network għar-Ritorn f’Livell Għoli return NL Netwerk op hoog niveau voor terugkeer Related term(s) J L M European Border and Coast Guard Agency (Frontex) Return Coordinator N PT Rede de Alto Nível para o Retorno RO Rețea la nivel înalt pentru returnare EMN Asylum and Migration Classification O PL SK Sieť na vysokej úrovni pre návraty SL Mreža na visoki ravni za vračanje SV återvändandenätverk på hög nivå NO returnettverk på høyt nivå (b); returnettverk på høgt nivå (n) KA მაღალი დონის ქსელი დაბრუნების საკითხებში UK Мережа високого рівня з питань повернення HY Վերադարձի բարձրաստիճան ցանց 2.2 EU (e.g. Common European Asylum System, Qualification Directive, European Agenda for Migration)| 12. Return and Readmission Euro Voc Classification P Q 1011 European Union law| 2811 migration R Note(s) 1. On 8 September 2022, the first High-Level Network for Returns was launched, comprising senior representatives from EU Member States and Schengen Associated Countries’ institutions responsible for returns and the Frontex Deputy Executive Director for Return Operations. 2. The EU Return Coordinator and the High Level Network for Returns also play an important role in the development of the EU Strategy on voluntary return and reintegration, proposed by the Commission in April 2021, European Commission: Communication: the EU strategy on voluntary return and reintegration, COM(2021) 120 final. S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 287
High-Level Working Group (HLWG) on Asylum and Migration BG Работна група на високо равнище „Убежище и миграция“ CS Pracovní skupina na vysoké úrovni pro azyl a migraci DE Hochrangige Arbeitsgruppe Asyl und Einwanderung / Hochrangige Gruppe Asyl und Migration EL Ομάδα Εργασίας Υψηλού Επιπέδου για το ‘Ασυλο και τη Μετανάστευση EN High-Level Working Group (HLWG) on Asylum and Migration ES grupo de trabajo de alto nivel sobre migración y asilo Definition(s) A strategic group which works under the auspices of the European Council and which was set up to establish a comprehensive and integrated strategy for the EU’s cooperation with third countries in the area of asylum and migration. Source(s) Council Conclusions C/98/431 on the Asylum and Migration Task Force at the 2148th Council Meeting General Affairs,- 6th/7th December 1998 ET kõrgetasemeline varjupaiga ja rände töörühm Synonym(s) FI Turvapaikka- ja maahanmuuttoasioiden korkean tason työryhmä HLWG Related term(s) FR Groupe de travail de haut niveau «Asile et Migration» GA Grúpa Oibre Ardleibhéil maidir le Tearmann agus Imirce Global Approach to Migration and Mobility (GAMM) Strategic Committee on Immigration, Frontiers and Asylum HR Radna skupina na visokoj razini za azil i migracije EMN Asylum and Migration Classification HU Magas Szintű Menekültügyi és Migrációs Munkacsoport 15.1 EU External dimension of migration and mobility IT Gruppo di lavoro ad alto livello in materia di asilo e migrazione Euro Voc Classification 10 European Union| 2811 migration LT Prieglobsčio ir migracijos aukšto lygio darbo grupė LV Augsta līmeņa darba grupa migrācijas un patvēruma jautājumos MT Grupp ta’ Ħidma ta’ Livell Għoli dwar l-Ażil u l-Migrazzjoni NL Werkgroep op hoog niveau voor asiel en migratie PL Grupa Robocza Wysokiego Szczebla ds. Azylu i Migracji PT Grupo alto nível asilo e migração RO Grupul de lucru la nivel înalt în domeniul migraţiei şi azilului Note(s) 1. The HLWG was set up in December 1998 to prepare cross-pillar Action Plans for the countries of origin and transit of asylum seekers and migrants. 2. The HLWG’s focus is on external relations with third countries, particularly within the context of the Global Approach to Migration and Mobility (GAMM). Its objective is to strengthen the external dimension of the EU’s asylum and migration policies based on dialogue, cooperation and partnership with countries of origin and transit in the areas of legal migration, irregular migration, migration and development. The Group also prepares conclusions and recommendations on asylum and migration to be adopted by the Council. They carry out an assessment of the political, economic and human rights situation in countries of origin and provide a joint analysis of the causes and consequences of migration. SK Pracovná skupina na vysokej úrovni (HLWG) pre azyl a migráciu SL Delovna skupina na visoki ravni za azil in migracije SV högnivågruppen för asyl och migration NO høynivågruppen for asyl og migrasjon (b); høgnivågruppa for asyl og migrasjon (n) KA თავშესაფრისა და მიგრაციის საკითხთა მაღალი დონის სამუშაო ჯგუფი (HLWG) UK Робоча група високого рівня (HLWG) з питань притулку та міграції HY 288 Ապաստանի և միգրացիայի հարցերով բարձր մակարդակի աշխատանքային խումբ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B highly qualified employment BG висококвалифицирана заетост C D Definition(s) CS zaměstnání vyžadující vysokou kvalifikaci The employment of a person who: (a) in the EU Member State concerned, is protected as an employee under national employment law and / or in accordance with national practice, irrespective of the legal relationship, for the purpose of exercising genuine and effective work for, or under the direction of someone else: (b) is paid; and, (c) has the required adequate and specific competence, as proven by higher professional qualifications. DE hochqualifizierte Beschäftigung EL απασχόληση υψηλής εξειδίκευσης EN highly qualified employment ES empleo altamente cualificado ET kõrgelt kvalifitseeritud töö FI korkeaa pätevyyttä vaativa työ FR emploi hautement qualifié GA fostaíocht ardcháilíochta Source(s) HR visokokvalificirano zapošljavanje E F G H I HU magasan képzett munkavállalók foglalkoztatása Art. 2(b) of Council Directive 2009/50/EC (Blue Card Directive) J IT lavoro altamente qualificato Related term(s) K LT aukštos kvalifikacijos darbas (EU acquis); aukštos profesinės kvalifikacijos reikalaujantis darbas EU Blue Card highly qualified migrant LV augsti kvalificēta nodarbinātība L EMN Asylum and Migration Classification MT Impjieg bi kwalifiki għoljin M 3.1 Migration for Economic Purposes NL hooggekwalificeerde baan PL zatrudnienie pracowników wysoko wykwalifikowanych Euro Voc Classification 2811 migration| 4406 employment N Note(s) O PT emprego altamente qualificado RO loc de muncă înalt calificat SK vysokokvalifikované zamestnanie SL visokokvalificirana zaposlitev SV högkvalificerad anställning NO sysselsetting av høyt kvalifisert arbeidskraft (b); sysselsetjing av høgt kvalifisert arbeidskraft (n) In some EU Member States, there is a distinction between ‘highly skilled’, referring to someone who has the required adequate and specific competence as proven by higher educational qualifications and / or extensive (vocational) experience; and ‘highly qualified’, referring to someone who has required adequate and specific competence as proven by higher educational qualifications only. In the EU context, however, these terms are considered to be interchangeable. Q R KA მაღალკვალიფიციურ მიგრანტთა დასაქმება UK висококваліфікована зайнятість HY P S բարձր որակավորման աշխատանք T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 289
highly qualified migrant BG висококвалифициран миграант CS vysoce kvalifikovaný migrant Definition(s) GA imirceach ardcháilithe In the global context, a person falling within ILO ISCO-88 Classes 1, 2 and 3, e.g. a person qualified as a manager, executive, professional, technician or similar, who moves within the internal labour markets of transnational corporations and international organisations, or who seeks employment through international labour markets for scarce skills. In the EU context, a third-country national who seeks employment in an EU Member State and has the required adequate and specific competence, as proven by higher professional qualifications. HR visokokvalificirani migrant Source(s) DE hochqualifizierter Migrant EL μετανάστης υψηλής εξειδίκευσης EN highly qualified migrant ES persona migrante altamente cualificada ET kõrgelt kvalifitseeritud sisserändaja FI korkeasti koulutettu maahanmuuttaja FR migrant hautement qualifié HU magasan képzett migráns IT migrante altamente qualificato LT aukštos profesinės kvalifikacijos migrantas LV augsti kvalificēts migrants MT Migrant(a) bi kwalifiki għoljin Global context: UNESCO Glossary of Migration-related Terms EU context: Derived by EMN from Art. 2(b) of Council Directive 2009/50/EC (Blue Card Directive) Synonym(s) PL migrant wysoko wykwalifikowany business migrant highly qualified migrant worker highly skilled migrant PT migrante altamente qualificado Broader term(s) NL hooggekwalificeerde migrant RO migrant înalt calificat SK vysokokvalifikovaný migrant SL visokokvalificirani migrant SV högkvalificerad migrant NO høyt kvalifisert migrant (b); høgt kvalifisert migrant (n) KA მაღალკვალიფიციური მიგრანტი UK висококваліфікований мігрант HY բարձր որակավորում ունեցող միգրանտ migrant worker Related term(s) EU Blue Card holder highly qualified employment mutual recognition agreement EMN Asylum and Migration Classification 3.1 Migration for Economic Purposes Euro Voc Classification 2811 migration| 4406 employment Note(s) 1. In some EU Member States, there is a distinction between ‘highly skilled’, referring to someone who has the required adequate and specific competence, as proven by higher educational qualifications, and / or extensive (vocational) experience; and ‘highly qualified’, referring to someone who has required adequate and specific competence, as proven by higher educational qualifications only. In the EU context, however, these terms are considered to be interchangeable, e.g. the definition for ‘highly skilled’ used in Regulation (EC) No 862/2007 (Migration Statistics Regulation) uses the definition for ‘highly qualified’. 2. The understanding of who is a ‘highly qualified’ and a ‘qualified third-country national’ varies in the EU Member States, with different definitions and concepts existing. Often these depend on national labour market demands and other national criteria. For more information, see EMN: Attracting highly qualified and qualified third-country nationals, 2013 . 290 EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B host country BG приемаща държава /държава домакин CS hostitelský stát C D Definition(s) DE Aufnahmeland The EU Member State / country in which a third-country national / non-national takes up residence. E EL χώρα υποδοχής Source(s) EN host country Developed by EMN F ES país de acogida Synonym(s) G ET vastuvõttev riik receiving country FI vastaanottava maa Narrower term(s) H FR pays d’accueil host Member State GA tír aíochta Related term(s) I HR zemlja domaćin HU fogadó ország IT paese ospitante LT priimančioji valstybė host society right of residence J Euro Voc Classification K 2811 migration L LV uzņēmējvalsts MT Pajjiż li jilqa’ / li jospita M NL gastland PL kraj przyjmujący N PT país de acolhimento RO ţară gazdă O SK hostiteľská krajina / prijímajúca krajina SL država gostiteljica P SV värdland NO vertsland Q KA მიმღები ქვეყანა R UK приймаюча країна HY ընդունող երկիր S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 291
host entity BG приемаща страна CS hostitelský subjekt DE aufnehmende Einrichtung EL οντότητα υποδοχής, οντότητα εισδοχής EN host entity ES organismo de acogida ET vastuvõttev üksus FI vastaanottava yksikkö FR entité d’accueil GA eintiteas aíochta Definition(s) A research organisation, a higher education institution, an education establishment, an organisation responsible for a voluntary service scheme or an entity hosting trainees to which the third-country national is assigned for the purposes of Directive 2016/801/EU (Recast Researcher›s Directive) and which is located in the territory of the EU Member State concerned, irrespective of its legal form, in accordance with national law. Source(s) HR subjekt domaćin Art. 3(14) of Directive 2016/801/EU (Recast Researcher’s Directive) HU fogadó entitás EMN Asylum and Migration Classification IT Ente ospitante 3.3 Migration for Study and Research LT priimantysis subjektas Euro Voc Classification LV uzņemošā vienība 2811 migration| 3206 education MT Entità li tospita NL gastentiteit PL podmiot goszczący PT entidade de acolhimento RO entitate gazdă SK hostiteľský subjekt SL subjekt gostitelj SV värdenhet NO vertsorganisasjon KA მიმღები დაწესებულება UK приймаючий суб’єкт / приймаюча організація HY 292 ընդունող կազմակերպություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B host Member State BG приемаща държава членка CS hostitelský členský stát DE Aufnahmemitgliedstaat EL κράτος μέλος υποδοχής EN host Member State ES Estado Miembro de acogida ET vastuvõttev liikmesriik FI vastaanottava jäsenvaltio FR État membre d’accueil GA ballstát aíochta HR država članica domaćin HU fogadó tagállam IT Stato membro ospitante C D Definition(s) The EU Member State to which a union citizen moves in order to exercise their right to free movement and residence. Source(s) F Art. 2(3) of Council Directive 2004/38/EC (Free Movement Directive) G Broader term(s) H EMN Asylum and Migration Classification I Euro Voc Classification J host country 3. Legal Migration 1011 European Union law| 2811 migration K LT priimančioji valstybė narė L LV uzņēmējdalībvalsts MT Stat Membru li jospita M NL gastlidstaat PL przyjmujące państwo członkowskie N PT Estado Membro de acolhimento RO Stat Membu gazdă O SK hostiteľský členský štát / prijímajúci členský štát SL država članica gostiteljica P SV mottagande medlemsstat NO vertsmedlemsland Q KA ევროკავშირის წევრი მიმღები სახელმწიფო R UK приймаюча держава-член ЄС HY E ընդունող անդամ պետություն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 293
host society BG приемащо общество CS hostitelská společnost DE Aufnahmegesellschaft EL κοινωνία υποδοχής EN host society ES sociedad de acogida ET vastuvõttev ühiskond FI vastaanottava yhteiskunta FR société d’accueil GA sochaí óstach HR društvo domaćina HU fogadó társadalom IT società di accoglienza LT priimančioji visuomenė LV vietējā sabiedrība MT Soċjetà li tilqa’ / li tospita NL gastsamenleving / gastmaatschappij PL społeczeństwo przyjmujące PT sociedade de acolhimento Definition(s) In the EU context, residents (both nationals and nonnationals) of a national / regional / local community within an EU Member State. Source(s) Developed by EMN Broader term(s) host Member State Related term(s) Common Basic Principles host country integration EMN Asylum and Migration Classification 9. Integration Euro Voc Classification 2811 migration Note(s) In accordance with integration being a dynamic, two-way process, the activities undertaken by the host society serve to facilitate the integration of a third-country national according to the Common Basic Principles. RO societate gazdă SK hostiteľská spoločnosť / prijímajúca spoločnosť SL družba gostiteljica SV värdsamhälle NO vertssamfunn KA მიმღები საზოგადოება UK приймаюче суспільство HY 294 ընդունող հասարակություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B hotspot approach BG подход за създаване на горещи точки / система за горещи точки C D Definition(s) FR approche des hotspots Approach where the European Union Agency for Asylum (EUAA), the European Border and Coast Guard Agency (Frontex), the European Union Agency for Law Enforcement Cooperation (Europol) and the European Union Agency for Criminal Justice Cooperation (Eurojust) work on the ground with the authorities of frontline EU Member States which are facing disproportionate migratory pressures at the external EU borders to help to fulfil their obligations under EU law and swiftly identify, register and fingerprint incoming migrants. GA Cur Chuige Ball Te Source(s) CS přístup s využitím hotspotů DE Hotspot-Konzept; Brennpunkt-System (EU acquis) EL Σύστημα κομβικών σημείων υποδοχής / χοτ σποτ EN hotspot approach ES Enfoque Hotspot ET esmase vastuvõtu süsteem FI hotspot-lähestymistapa HU hotspot megközelítés Hotspot System LT migrantų antplūdžio valdymo modelis hotspot area MT Sistema ta’ approċċ f’hotspots / f’inħawi mwiegħra PL podejście Hotspot / system Hotspot / w kontekście wsparcia państw członkowskich, które zmagają się z presjąmigracyjną na granicach zewnętrznych UE RO abordare hotspot SK koncepcia krízových vstupných centier a problémových oblastí (EU acquis); systém hotspotov / systém migračných hotspotov SL pristop žariščnih točk SV hotspot-metod NO helhetlig prosedyre (b); helheitleg prosedyre (n) KA ცხელი წერტილის მიდგომა UK підхід гарячих точок HY թեժ կետի մոտեցում 4.1 International protection| 6.2 Procedure for international protection/Refugee status determination N Euro Voc Classification O 2811 migration PT sistema de centros de registo I M EMN Asylum and Migration Classification NL hotspot-systeem H L Narrower term(s) LV karsto punktu pieeja G K Synonym(s) IT sistema basato sui punti di crisi F J European Commission: Communication: A European Agenda on Migration, COM(2015) 240 final HR pristup žarišnih točaka/hotspot pristup E P Note(s) 1. The hotspot approach was developed by the European Commission as part of the immediate action to assist EU Member States located at the external EU border and presented in the European Agenda on Migration in May 2015 . 2. The operational support provided under the Hotspot Approach will concentrate on registration, identification, fingerprinting and debriefing of asylum seekers, as well as return operations. Those claiming asylum will be immediately channelled into an asylum procedure where EUAA support teams will help to process asylum applications as quickly as possible. For those who are not in need of protection, Frontex will help EU Member States by coordinating the return of irregular migrants. Europol and Eurojust will assist the host Member State with investigations to dismantle smuggling and trafficking networks. 3. IT and GR are the first two EU Member States where this hotspot approach is currently being implemented. Other EU Member States will also be able to benefit from the hotspot approach upon request. 4. The hotspot approach will also contribute to the implementation of the temporary relocation schemes proposed by the European Commission on 27 May and 9 September 2015: people in clear need of international protection will be identified in frontline EU Member States for relocation to other EU Member States where their asylum application will be processed. Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 295
hotspot area BG зона на гореща точка CS oblast hotspotu DE Brennpunkt (EU-acquis); Hotspot-Gebiet EL κομβικό σημείο υποδοχής (χοτ σποτ / hotspot) EN hotspot area ES punto crítico ET esmase vastuvõtu piirkond FI hotspot-alue FR zone d’urgence migratoire (EU acquis); zone hotspot (BE, FR, LU) GA Limistéar Ball Te HR žarišno poručje/hotspot područje HU hotspot terület IT Punto di crisi LT migrantų antplūdžio valdymo vieta LV karsto punktu zona MT Żona hotspot / f’sitwazzjoni mwieġħra Definition(s) An area in which the host Member State, the European Commission, relevant EU agencies and participating EU Member States cooperate, with the aim of managing an existing or potential disproportionate migratory challenge characterised by a significant increase in the number of migrants arriving at the external EU border. Source(s) Art. 2(10) of Regulation 2016//1624 (European Border and Coast Guard Regulation) Broader term(s) hotspot approach EMN Asylum and Migration Classification 6.2 Procedure for international protection/Refugee status determination Euro Voc Classification 2811 migration NL hotspotgebied PL obszar hotspot PT zona dos pontos de crise RO zonă hotspot SK oblasť krízových vstupných centier / oblasť hotspotov SL žariščna točka SV hotspot-område / utsatt område NO mottakssted for asylsøkere etablert ved et uvanlig stort antall (b); mottaksstad for asylsøkjarar etablert ved eit uvanleg stort tal (n) KA ცხელი წერტილის ზონა UK зона гарячих точок HY 296 թեժ կետ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B human rights C BG човешки права CS lidská práva DE Menschenrechte EL δικαιώματα του ανθρώπου / ανθρώπινα δικαιώματα EN human rights ES derechos humanos ET inimõigused FI ihmisoikeudet FR droits de l’homme GA cearta an duine HR ljudska prava HU emberi jogok IT diritti umani LT žmogaus teisės LV cilvēktiesības MT Drittijiet (Id-) tal-bniedem NL mensenrechten D Definition(s) E Agreed international standards that recognise and protect the dignity and integrity of every individual, without any distinction. F Source(s) UNHCR Master Glossary of Terms G Related term(s) Charter of Fundamental Rights of the European Union European Convention on Human Rights (ECHR) European Union Agency for Fundamental Rights (FRA) fundamental rights H Euro Voc Classification J 1236 rights and freedoms K Note(s) 1. Human rights form part of customary international law and are stipulated in a variety of national, regional and international legal documents generally referred to as human rights instruments. 2. In the EU the preferred term to use is fundamental rights. PL prawa człowieka L M N PT direitos humanos RO drepturile omului / drepturi ale omului O SK ľudské práva SL človekove pravice P SV mänskliga rättigheter NO menneskerettigheter (b); menneskerettar (n) Q KA ადამიანის უფლებები R UK права людини HY I մարդու իրավունքներ S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 297
human rights law BG закон за човешките права CS (mezinárodní) právo v oblasti lidských práv DE internationale Menschenrechtsnormen EL δίκαιο των δικαιωμάτων του ανθρώπου / δίκαιο των ανθρωπίνων δικαιωμάτων Definition(s) The body of customary international law, human rights instruments and national law that recognises and protects human rights. Source(s) EN human rights law UNHCR Master Glossary of Terms ES legislación de derechos humanos Related term(s) ET inimõiguste õigus FI ihmisoikeuslainsäädäntö FR droit relatif aux droits de l’homme GA na dlíthe i leith Chearta an Duine, reachtaíocht i leith Chearta an Duine HR pravo u području ljudskih prava HU emberi jogi joganyag IT diritto dei diritti umani European Convention on Human Rights (ECHR) refugee law fundamental rights Euro Voc Classification 1236 rights and freedoms Note(s) Refugee law and human rights law complement each other. LT žmogaus teisių teisė LV cilvēktiesību normas MT Liġi (Il-) dwar id-drittijiet tal-bniedem NL humanitair recht PL prawo praw człowieka PT legislação sobre direitos humanos RO legislaţia privind drepturile omului SK právo v oblasti ľudských práv SL pravo o človekovih pravicah SV lagstiftning till skydd för mänskliga rättigheter NO menneskerettslovgivning (b); menneskerettslovgjeving (n) KA ადამიანის უფლებათა სამართალი UK право у сфері прав людини HY 298 մարդու իրավունքների մասին օրենք EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B humanitarian admission BG хуманитарен прием C D Definition(s) CS humanitární přijetí In the EU context, the admission following, where requested by an EU Member State, a referral from the European Union Agency for Asylum (EUAA), the United Nations High Commissioner for Refugees (UNHCR), or another relevant international body, of third-country nationals or stateless persons from a third country to which they have been forcibly displaced to the territory of EU Member States, and who are granted international protection or humanitarian protection under national law that provides for rights and obligations equivalent to those of Art. 20 to 34 of Directive 2011/95/EU (Recast Qualification Directive) for beneficiaries of subsidiary protection. DE Aufnahme aus humanitären Gründen EL εισδοχή για ανθρωπιστικούς λόγους EN humanitarian admission ES admisión humanitaria ET humanitaarsetel kaalutlustel vastuvõtmine FI humanitaarinen maahanpääsy FR admission humanitaire GA ligean isteach ar fhoras daonnúil HR humanitarni prihvat HU humanitárius befogadás Source(s) IT ammissione umanitaria E F G H I J LT humanitarinis priėmimas Derived by EMN from Art. 2(5) of Regulation (EU) 2021/1147 (AMIF-Regulation) K LV uzņemšana humānu apsvērumu dēļ Broader term(s) MT Ammissjoni umanitarja legal pathway L NL humanitaire toelating (NL), humanitaire admissie (BE) Related term(s) M PL zgoda na pobyt humanitarny PT admissão humanitária RO admisie umanitară SK humanitárne prijatie / humanitárne prijímanie SL humanitarni sprejem SV humanitärt mottagande NO adgang til riket på humanitært grunnlag KA ქვეყანაში დაშვება ჰუმანიტარული მიზნით UK гуманітарний прийом HY մարդասիրական ընդունելություն humanitarian visa resettlement N EMN Asylum and Migration Classification 5. Relocation, Resettlement and Humanitarian Admission Euro Voc Classification O 1011 European Union law| 2811 migration P Note(s) Q 1. There is no commonly agreed upon definition of humanitarian admission and no clear difference between resettlement and humanitarian admission in general. 2. EU legislation distinguishes between humanitarian admission and resettlement, with resettlement specifically designed for formally recognised refugees, while humanitarian admission may imply the granting of international protection or humanitarian protection under national laws. 3. Humanitarian admission is discussed in the EU in the broader concept of legal pathways or avenues for refugees and in this context, it is possible to identify three broad categories of legal pathways for refugees from current State practices: ƒ First, resettlement programmes are a long-standing form of humanitarian admission that have been developed specifically for those who have been formally recognized as refugees; ƒ Second, evacuation programmes are aimed at bringing civilians to safety following a humanitarian emergency caused by a disaster and/or armed conflict. These are large-scale responses and, contrary to resettlement programmes, their implementation does not presuppose an individual assessment nor impose any requirement that a person has specific vulnerabilities; ƒ Third, some States provide for protected entry procedures (PEPs), which are formalised procedures that allow foreigners to individually and directly petition the State to obtain humanitarian admission to their territory. In such procedures, the individual is directly engaging the potential host State in a procedure aiming at securing his or her physical transfer and legal protection. 4. For further information see the EMN study Comparative overview of national protection statuses in the EU and Norway, Synthesis Report May 2020 and Humanitarian Admission to Europe: The Law between Promises and Constraints, 1st edition, 2020. EMN ASYLUM AND MIGRATION GLOSSARY 10.0 299 R S T U V W X Y Z
humanitarian protection BG хуманитарен статут CS humanitární ochrana Definition(s) ES protección humanitaria National type of protection which is granted in cases where applicants for international protection are found not to be eligible for recognition as refugees or beneficiaries of subsidiary protection, but who are nonetheless considered to be in need of protection due to special humanitarian reasons. ET humanitaarkaitse Source(s) DE humanitärer Schutz EL ανθρωπιστική προστασία EN humanitarian protection FI humanitaarinen suojelu Developed by EMN FR protection humanitaire Broader term(s) GA cosaint dhaonnúil protection HR humanitarna zaštita Related term(s) HU humanitárius védelem IT protezione umanitaria LT humanitarinė apsauga LV humānā aizsardzība MT Protezzjoni umanitarja NL bescherming op humanitaire gronden PL ochrona o charakterze humanitarnym PT proteção humanitária RO protecţie umanitară SK humanitárna ochrana SL humanitarna zaščita SV humanitärt skydd NO beskyttelse på humanitært grunnlag (b); vern på humanitært grunnlag (n) KA ჰუმანიტარული დაცვა UK гуманітарний захист HY 300 մարդասիրական պաշտպանություն de facto refugee international protection subsidiary protection EMN Asylum and Migration Classification 4.2.2 Humanitarian protection Euro Voc Classification 2811 migration Note(s) 1. Humanitarian protection is not harmonised at EU level. 2. National protection statuses cater for a wide variety of needs and situations, exceeding the grounds for international protection under Union acquis. These include collective protection, protection based on general humanitarian grounds, on exceptional circumstances or on serious health conditions, protection for climate change reasons and environmental disasters in the country of origin, protection based on the principle of non-refoulement and protection for minors and unaccompanied minors and for beneficiaries of specific programmes (relocation, resettlement). 3. The grounds for the national protection statuses remain largely undefined in national legislation. This may leave a significant margin of discretion to competent authorities, often to ensure compliance with obligations under international law or to serve national interests. This may potentially create challenges for authorities in assessing applications, as well as for applicants when lodging a claim for national protection. 4. Outside EU, humanitarian protection is granted for comparable protection needs, including but not limited to ƒ victims of human rights violations in their country of origin; ƒ victims of certain particularly heinous crimes in the country of destination (such as rape, torture, trafficking in human beings, female genital mutilation and others); ƒ victims of hate crimes. Humanitarian visas can also be issued in the event of: ƒ natural disasters; ƒ economic difficulties in the country of origin; ƒ serious illness and lack of adequate treatment in the country of origin; ƒ individual need for protection. 5. For further information see: European Migration Network: Comparative overview of national protection statuses in the EU and Norway, Study, 2019 and IOM Glossary on Migration, 2019. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 301
humanitarian visa BG хуманитарна виза CS humanitární vízum DE Visum aus humanitären Gründen EL θεώρηση για ανθρωπιστικούς λόγους EN humanitarian visa ES visado humanitario ET humanitaarviisa FI humanitaarinen viisumi FR visa humanitaire GA víosa ar fhoras daonnúil HR humanitarna viza HU humanitárius vízum IT LT humanitarinė viza LV humānu apsvērumu dēļ izsniegta vīza MT Viża għal raġunijiet umanitarji NL PL wiza wydana z przyczyn humanitarnych PT visto humanitário RO viză umanitară SK humanitárne vízum Definition(s) In the global context, a visa granting access to and temporary stay in the issuing State for a variable duration to a person on humanitarian grounds as specified in the applicable national or regional law, often aimed at complying with relevant human rights and refugee law. In the EU context, (a) derogation from the admissibility requirements for the issuance of a visa based on humanitarian grounds in accordance with Art. 19(4) of the Visa Code or b) issuance of a short-stay Schengen visa with limited territorial validity (LTV) on humanitarian grounds in accordance with Art. 25(1) of the Code. Source(s) Global context: IOM Glossary on Migration, 2019 EU-context: Derived by EMN from Art. 19(4) and 25(1) of Regulation (EC) No 810/2009 (Visa Code) Synonym(s) visa on humanitarian grounds Broader term(s) legal pathway Related term(s) SL humanitarni vizum humanitarian admission resettlement SV visering av humanitära skäl EMN Asylum and Migration Classification NO visum på humanitært grunnlag KA ჰუმანიტარული ვიზა 5. Relocation, Resettlement and Humanitarian Admission| 6.1.2 Visa policy UK гуманітарна віза Euro Voc Classification HY 302 Մարդասիրական վիզա, որը տրվում է որոշ երկրների կողմից՝ փախստականներին հետապնդումներից պաշտպանելու իրենց միջազգային պարտավորությունը կատարելու նպատակով 1011 European Union law| 2811 migration EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. Humanitarian visa are generally understood as authorisations to access the territory of a State, and which are granted by derogation from the applicable rules because of specific humanitarian reasons. They are considered an alternative procedure for protected entry that allow persons in need of protection legal access to a third country and/or to apply for international protection, with an initial assessment being carried out extraterritorially and the merits of the application being examined on the spot upon arrival through international protection procedures or procedures for another status. 2. Humanitarian visas can be granted by the visa-issuing authority of the State in the applicant’s country of origin or in a country of destination, and exceptionally also at the border of the visa-issuing State or to persons who are already within the State. Beyond granting legal access to and temporary stay in the State, humanitarian visas rarely provide the person with any further entitlement to protection or services. 3. There is currently no EU regulation on humanitarian visas per se, nor is there a specific procedure. However, under the Visa Code, which sets out the procedures and conditions for issuing visas for the purpose of short stays and airport transit within the Schengen area, provision is made for visas to be issued “on humanitarian grounds”. These visas are often referred to as ‘humanitarian visas’, the provision of such visa as ‘protected entry’. Pursuant to Art. 33(1) of the Visa Code a visa’s duration can also be extended on humanitarian grounds. While Art. 19(4) of the Visa Code regulates exemptions from the admissibility requirements for visa applications, Art. 25(1) provides for exemptions from the fulfilment of the Schengen visa obligation. However, there is no automatic link between exemption from the admissibility requirements and the issuance of an LTV visa on humanitarian grounds. 4. On 7 March 2017, the Court of Justice of the European Union (CJEU) ruled that EU Member States are not obliged, under EU law, to grant a humanitarian visa as the issuing of LTV visas falls solely on national law because there is no explicit provision regarding how they should be issued in the Visa Code. For more information see the judgement of the CJEU. 5. However, humanitarian visas are also part of legal pathways for persons in need of protection, which include the following: ƒ resettlement; ƒ humanitarian admission programmes; ƒ simplifying visa requirements for certain nationalities or certain groups; ƒ more generous use of family reunification rules; ƒ use of existing channels for legal migration for the purposes of labour and study. 6. For more information see: Fundamental Rights Agency (FRA): Legal entry channels to the EU for persons in need of international protection: a toolbox, 2015 and European Parliament: Briefing: Towards an EU humanitarian visa scheme? June 2016. 7. IE is not bound by the Visa Code. The qualification criteria for a visa may be waived on humanitarian grounds or visas may be granted to facilitate entry for resettlement or humanitarian admission programmes under national law. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 303
identification BG установяване на самоличността“ CS identifikace DE Identifizierung EL ταυτοποίηση EN identification Definition(s) The process of determining a person’s identity through a database search against multiple sets of data (one-to-many check). Source(s) FR identification Art. 3 (1)14) of Regulation (EU) 2017/2226 (Entry/Exit System (EES)-Regulation) and Art. 4 (6) of Regulation 2019/817 on establishing a framework for interoperability between EU information systems in the field of borders and visa GA sainaithint Broader term(s) ES identificación ET isiku tuvastamine FI tunnistaminen HR identifikacija establishment of identity HU személyazonosítás Related term(s) IT identificazione LT nustatymas LV identifikācija MT Identifikazzjoni NL identificatie PL identyfikacja verification of identity EMN Asylum and Migration Classification 6.3.2. Establishment of identity of applicants for international protection (incl. examination of documents, language analysis, age assessment) Euro Voc Classification 2811 migration PT identificação RO SK identifikácia SL ugotavljanje identitete SV identifiering NO identifisering KA იდენტიფიცირება UK ідентифікація HY 304 նույնականացում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B identification mission BG мисия за идентифициране CS identifikační mise DE Mission zur Identitätsfeststellung / Identifikationsmission EL αναγνωριστική αποστολή EN identification mission ES Misión de identificación ET isikutuvastamise missioon FI identifiointikäynti (not in general use) FR mission d’identification In the context of return, an operation conducted at the national level, on the basis of bilateral agreements or Memoranda of Understanding between the EU or EU Member States and third countries, by which teams of experts from these third countries are invited to/ deployed in EU Member States in order to officially confirm the nationality and complete the identification process of their nationals, who are not eligible for stay in the EU. E Source(s) I HR idenitifikacijska misija HU azonosítási misszió EMN Asylum and Migration Classification IT missione di identificazione LT tapatybės nustatymo misija LV identificēšanas misija MT Missjoni t’ identifikazzjoni NL Identificatiemissie PL misja identyfikacyjna PT missão de identificação RO misiune de identificare SK misia za účelom identifikácie štátneho príslušníka tretej krajiny SL misija za identifikacijo SV identifieringsuppdrag NO ID-avklaringsoppdrag KA მაიდენტიფიცირებელი მისია UK місія з ідентифікації HY նույնականացման առաքելություն D Definition(s) Derived by EMN from the European Commission:Fact sheet on the Partnership Framework on Migration, 13 June 2017. GA C F G H J 6.3.2. Establishment of identity of applicants for international protection (incl. examination of documents, language analysis, age assessment) Euro Voc Classification K L 2811 migration M Note(s) N 1. Improving return and readmission has been a key objective under the Partnership Framework with third countries. It has used formal approaches such as the negotiation of readmission agreements and more informal tools, such as Standard Operating Procedures and conducting technical and identification missions. 2. These missions are used by EU Member States to unblock cases where return has failed due to a missing return document. The purpose of the missions is to determine the nationality of the return candidate. 3. They are conducted under the aegis of the European Border and Coast Guard Agency (Frontex). Frontex distinguishes between long-term identification missions (i.e. whereby the deployment of third country experts in an EU Member State takes place over a long period of time) and short-term Identification missions (i.e. ad hoc missions). 4. For more information about the effectiveness of identification missions compared to other tools see: Fourth Progress Report on the Partnership Framework with third countries under the European Agenda on Migration, Reportfrom the EU Commission, COM (2017) 350 final. O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 305
identification of a victim of trafficking in human beings BG идентификация на жертва на трафик на хора CS identifikace oběti obchodování s lidmi DE Feststellung eines Opfers von Menschenhandel / Identifizierung eines Opfers von Menschenhandel EL αναγνώριση θύματος εμπορίας ανθρώπων (EL); αναγνώριση θύματος εμπορίας προσώπων (CY) Definition(s) The process of confirming and characterising a situation of trafficking in human beings for further implementation of support. Source(s) EN identification of a victim of trafficking in human beings Derived by EMN from Varandas, I. & J. Martins: Signalling Identification Integration of Victims of Trafficking for Sexual Exploitation: Construction of a Guide, 2007 ES identificación de víctima de trata de seres humanos Broader term(s) ET inimkaubanduse ohvri tuvastamine trafficking in human beings FI ihmiskaupan uhrin tunnistaminen Narrower term(s) FR identification d’une victime de la traite des êtres humains formal identification of a victim of trafficking in human beings GA íospartach gáinneála a shainaithint Related term(s) HR identifikacija žrtve trgovanja ljudima detection of a victim of trafficking in human beings HU emberkereskedelem áldozatának azonosítása EMN Asylum and Migration Classification IT identificazione della vittima di tratta di esseri umani 13.2 Trafficking in human beings LT prekybos žmonėmis aukos nustatymas Euro Voc Classification LV cilvēku tirdzniecības upura identificēšana 2811 migration MT Identifikazzjoni (L-) ta’ vittma fit-traffikar tal-persuni NL herkennen van een slachtoffer van mensenhandel PL identyfikacja ofiar handlu ludźmi PT identificação de vítima de tráfico de seres humanos RO identificarea unei victime a traficului de fiinţe umane SK identifikácia obete obchodovania s ľuďmi SL prepoznavanje žrtve trgovine z ljudmi SV identifiering av offer för människohandel NO identifisering av offer for menneskehandel KA ადამიანით ვაჭრობის (ტრეფიკინგის) მსხვერპლის იდენტიფიცირება UK ідентифікація особи, яка постраждала від торгівлі людьми HY 306 մարդկանց թրաֆիքինգի զոհի նույնականացում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
identified victim of trafficking in human beings BG идентифицирана жертва на трафик на хора A B C D Definition(s) CS identifikovaná oběť obchodování s lidmi E A person who has been formally identified as a victim of trafficking in human beings according to the relevant formal authority in EU Member States. DE identifiziertes Opfer von Menschenhandel EL αναγνωρισμένο θύμα εμπορίας ανθρώπων (EL); αναγνωρισμένο θύμα εμπορίας προσώπων (CY) F Source(s) EN identified victim of trafficking in human beings ES victima reconocida de trata de seres humanos ET (tuvastatud) inimkaubanduse ohver Derived by EMN from Eurostat: Trafficking in human beings, 2013 G Broader term(s) H Related term(s) I EMN Asylum and Migration Classification J Euro Voc Classification K trafficking in human beings FI tunnistettu ihmiskaupan uhri FR victime identifiée de la traite des êtres humains vulnerable person GA íospartach gáinneála sainaitheanta HR identificirana žrtva trgovanja ljudima 13.2 Trafficking in human beings HU emberkereskedelem azonosított áldozata IT vittima identificata di tratta di esseri umani 2811 migration LT nustatyta prekybos žmonėmis auka L LV identificēts cilvēku tirdzniecības upuris MT Vittma identifikata fit-traffikar tal-persuni M NL geïdentificeerd slachtoffer van mensenhandel PL zidentyfikowana ofiara handlu ludźmi N PT pessoa identificada como vítima de tráfico de seres humanos O RO victimă a traficului de fiinţe umane identificată P SK identifikovaná obeť obchodovania s ľuďmi SL prepoznana žrtev trgovine z ljudmi Q SV identifierat offer för människohandel NO identifisert offer for menneskehandel R KA ადამიანით ვაჭრობის (ტრეფიკინგის) იდენტიფიცირებული მსხვერპლი S UK ідентифікована особа, яка постраждала від торгівлі людьми HY T մարդկանց թրաֆիքինգի ճանաչված զոհ U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 307
identity document BG документ за самоличност CS průkaz totožnosti / doklad totožnosti Definition(s) DE Identitätsdokument A document issued by a State authority to an individual for providing evidence of the identity of that individual. EL έγγραφο ταυτότητας Source(s) EN identity document Developed by EMN ES Documento de identidad Synonym(s) ET isikut tõendav dokument FI henkilöllisyysasiakirja FR document d’identité GA Doiciméad aitheantais HR identifikacijska isprava HU személyazonosító okmány IT documento d’identità LT asmens tapatybės dokumentas / asmens tapatybę patvirtinantis dokumentas LV personu apliecinošs dokuments MT Dokument t’identità NL identiteitsdocument PL dokument tożsamości PT documento de identidade RO document de identitate SK identifikačný doklad / doklad totožnosti SL osebni dokument SV identitetshandling NO identitetsdokument KA პირადობის დამადასტურებელი დოკუმენტი ID card ID document Identity card Related term(s) fraudulent travel or identity document EMN Asylum and Migration Classification 6.3.2. Establishment of identity of applicants for international protection (incl. examination of documents, language analysis, age assessment) Euro Voc Classification 2811 migration Note(s) 1. An identity document asserts a unique single civil identity and defines such person’s identity in relation to the issuing state. It may contain the full name, parents’ names, age, date and place of birth, sex, address, profession, nationality as well as other biographic information, and additional electronic biometric data such as fingerprints, photographs, and face, hand, or iris measurements. 2. Identity documents are e.g. identity cards or passports. In some countries, such as UK driving licences, showing a photo of the holder, their date of birth and their home address, are used as general proof of identity. 3. Currently there is no EU-wide identity document, all EU Member States except DK and IE issue identity documents on a national basis. UK документ, що посвідчує особу HY 308 ինքնության փաստաթուղթ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B illegal employment BG незаконна заетост CS nelegální zaměstnávání C D Definition(s) DE illegale Beschäftigung Economic activity carried out in violation of provisions set by legislation. E EL παράνομη απασχόληση Source(s) F EN illegal employment ES empleo ilegal ET ebaseaduslik töötamine FI laiton työnteko FR emploi illégal Derived by EMN from definition for ‘clandestine employment’ in the ILO Thesaurus, 6th ed., 2008 G Synonym(s) H clandestine employment Narrower term(s) I HU illegális foglalkoztatás illegal employment of an illegally staying third-country national illegal employment of a legally staying third-country national IT lavoro illegale GA fostaíocht neamhdhleathach HR nezakonito zapošljavanje J Related term(s) LT nelegalus darbas irregular migrant K LV nelikumīga nodarbinātība EMN Asylum and Migration Classification L PL nielegalne zatrudnienie 13. Irregular Migration| 14.2 Economic factors and impacts (such as brain drain/gain, employment/ unemployment, labour market, economic growth, dumping) PT emprego ilegal Euro Voc Classification MT Impjieg illegali NL illegale tewerkstelling / illegale arbeid RO angajare ilegală / muncă la negru M N 2811 migration| 4406 employment O Note(s) P SK nelegálne zamestnávanie SL nezakonito zaposlovanje SV olaglig anställning NO illegalt arbeid KA არალეგალური დასაქმება UK нелегальне працевлаштування HY ապօրինի աշխատանք 1. In the EU context, this covers both the illegal employment of a third-country national who is irregularly staying on the territory of an EU Member State and of a legally resident third-country national working outside the conditions of the residence permit and/or without a work permit. 2. In the context of Directive 2009/52/EC (Employer Sanctions Directive) this means the employment of an illegally staying third-country national (see Art. 2(d)). Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 309
illegal employment of a legally staying third-country national BG незаконно наемане на законно пребиваващ гражданин на трета страна LV trešās valsts valstspiederīgā, kurš likumīgi uzturas valstī, nelikumīga nodarbinātība CS nelegální zaměstnávání oprávněně pobývajícího státního příslušníka třetí země MT Impieg illegali ta’ ċittadin(a) minn pajjiż terz residenti b’mod regolari DE illegale Beschäftigung eines Drittstaatsangehörigen mit rechtmäßigem Aufenthalt NL illegale tewerkstelling van legaal verblijvende derdelanders EL παράνομη απασχόληση νομίμως διαμένοντος πολίτη τρίτης χώρας PL nielegalne zatrudnienie obywatela państwa trzeciego przebywającego legalnie EN illegal employment of a legally staying third-country national PT emprego ilegal de nacional de estado terceiro em situação regular ES empleo ilegal de nacional de tercer país en situación de residencia legal RO angajare ilegală a unui resortisant dintr-o țară terță aflat în situație de ședere legală ET seaduslikult riigis viibiva kolmanda riigi kodaniku ebaseaduslik töötamine SK nelegálne zamestnávanie oprávnene sa zdržiavajúcich štátnych príslušníkov tretích krajín FI laillisesti oleskelevan kolmannen maan kansalaisen laiton työnteko SL nezakonita zaposlitev državljana tretje države, ki zakonito prebiva FR emploi illégal d’un ressortissant d’un pays tiers en séjour régulier SV olaglig anställning av tredjelandsmedborgare som vistas lagligt GA fostaíocht neamhdhleathach náisiúnaigh tríú tír atá i láthair go neamhdhleathach NO ulovlig sysselsetting av tredjestatsborgere med lovlig opphold (b); ulovleg sysselsetjing av tredjestatsborgarar med lovleg opphald (n) HR nezakonito zapošljavanje državljana treće zemlje koji zakonito boravi HU legálisan tartózkodó harmadik országbeli állampolgár illegális foglalkoztatása IT lavoro illegale di un cittadino di un paese terzo regolarmente soggiornante KA ლეგალურად მყოფი მესამე ქვეყნის მოქალაქის არალეგალური დასაქმება UK нелегальне працевлаштування громадянина третьої країни, який перебуває в країні легально HY LT teisėtai šalyje esančio trečiosios šalies piliečio nelegalus darbas 310 EMN ASYLUM AND MIGRATION GLOSSARY 10.0 օրինական բնակվող երրորդ երկրի քաղաքացու ապօրինի աշխատանք
A B C D Definition(s) E Employment of a legally staying third-country national working outside the conditions of their residence permit and / or without a work permit. which is is subject to each EU Member State’s national law. F G Source(s) Derived by EMN from definition of ‘illegal employment’ in Art. 2 (d) of Council Directive 2009/52/EC (Employer Sanctions Directive) H Broader term(s) I Related term(s) J illegal employment illegal employment of an illegally staying third-country national K EMN Asylum and Migration Classification L 14.2 Economic factors and impacts (such as brain drain/ gain, employment/ unemployment, labour market, economic growth, dumping) M Euro Voc Classification N 2811 migration| 4406 employment O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 311
illegal employment of an illegally staying third-country national BG незаконно наемане на незаконно пребиваващ гражданин на трета страна LV trešās valsts valstspiederīgā, kurš nelikumīgi uzturas valstī, nelikumīga nodarbinātība CS neoprávněné zaměstnávání neoprávněně pobývajícího státního příslušníka třetí země MT Impjieg illegali ta’ ċittadin(a) minn pajjiż terz residenti b’mod irregolari DE illegale Beschäftigung eines Drittstaatsangehörigen ohne rechtmäßigen Aufenthalt NL illegale tewerkstelling van illegaal verblijvende derdelanders EL παράνομη απασχόληση παρανόμως διαμένοντος πολίτη τρίτης χώρας PL nielegalne zatrudnienie obywatela państwa trzeciego przebywającego nielegalnie EN illegal employment of an illegally staying thirdcountry national PT emprego ilegal de nacional de estado terceiro em situação irregular ES empleo ilegal de nacional de tercer país en situación irregular RO angajare ilegală a unui resortisant dintr-o țară terță aflat în situație de ședere ilegală ET ebaseaduslikult riigis viibiva kolmanda riigi kodaniku ebaseaduslik töötamine SK nelegálne zamestnávanie neoprávnene sa zdržiavajúcich štátnych príslušníkov tretích krajín FI laittomasti oleskelevan kolmannen maan kansalaisen laiton työnteko SL nezakonita zaposlitev državljana tretje države, ki nezakonito prebiva FR emploi illégal d’un ressortissant d’un pays tiers en séjour irrégulier SV olaglig anställning av tredjelandsmedborgare som vistas olagligt GA fostú neamhdhleathach náisiúnaigh tríú tír atá i láthair go neamhdhleathach NO ulovlig sysselsetting av tredjestatsborgere uten lovlig opphold (b); ulovleg sysselsetjing av tredjestatsborgarar utan lovleg opphald (n) HR nezakonito zapošljavanje državljana treće zemlje koji nezakonito boravi HU illegálisan tartózkodó harmadik országbeli állampolgár illegális foglalkoztatása IT lavoro illegale di un cittadino di un paese terzo irregolarmente soggiornante KA არალეგალურად მყოფი მესამე ქვეყნის მოქალაქის არალეგალური დასაქმება UK нелегальне працевлаштування громадянина третьої країни, який перебуває в країні нелегально HY LT neteisėtai šalyje esančio trečiosios šalies piliečio nelegalus darbas 312 EMN ASYLUM AND MIGRATION GLOSSARY 10.0 ապօրինի բնակվող երրորդ երկրի քաղաքացու ապօրինի աշխատանք
A B C D Definition(s) Employment of an illegally staying third-country national. E Source(s) F Art. 2 (d) of Council Directive 2009/52/EC (Employer Sanctions Directive) G Broader term(s) H illegal employment Related term(s) employer sanction illegal employment of a legally staying third-country national third-country national found to be illegally present I EMN Asylum and Migration Classification K J 13. Irregular Migration| 14.2 Economic factors and impacts (such as brain drain/gain, employment/ unemployment, labour market, economic growth, dumping) L M Euro Voc Classification 2811 migration| 4406 employment N Note(s) O The term itself has been slightly modified from the Directive 2009/52/EC (Employer Sanctions Directive) definition in order to be more explicit. P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 313
immigrant BG имигрант CS přistěhovalec / imigrant DE Zuwanderer (EU acquis); Einwanderer / Immigrant EL μετανάστης EN immigrant ES inmigrante ET sisserändaja FI maahanmuuttaja FR immigrant Definition(s) In the global context, a non-resident (both national or alien) arriving in a State with the intention to remain for a period exceeding a year. In the EU context, a person who establishes their usual residence in the territory of an EU Member State for a period that is, or is expected to be, of at least 12 months, having previously been usually resident in another EU Member State or a third country. Source(s) HU bevándorló Global context: UN Recommendations on Statistics of International Migration EU context: Art. 2(b) and (f) of Regulation (EC) No 862/2007 (Migration Statistics Regulation) IT immigrato Synonym(s) GA inimirceach HR useljenik LT imigrantas Immigrant LV imigrants Broader term(s) MT Immigrant(a) migrant NL immigrant Related term(s) PL imigrant PT imigrante RO imigrant SK prisťahovalec / imigrant SL priseljenec emigrant immigration short-term migrant Euro Voc Classification 2811 migration SV invandrare NO innvandrer (b); innvandrar (n) KA იმიგრანტი UK іммігрант HY 314 ներգաղթող EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B immigration BG имиграция CS přistěhovalectví / imigrace DE Zuwanderung (EU acquis); Einwanderung / Immigration EL μετανάστευση EN immigration ES inmigración ET sisseränne FI maahanmuutto FR immigration GA inimirce HR useljavanje/imigracija HU bevándorlás IT immigrazione LT imigracija LV imigrācija MT Immigrazzjoni NL immigratie PL imigracja PT imigração RO imigraţie SK prisťahovalectvo / imigrácia C D Definition(s) In the global context, the act of arriving in a State with the intention to remain for a period exceeding one year. In the EU context, the action by which a person establishes their usual residence in the territory of an EU Member State for a period that is, or is expected to be, of at least 12 months, having previously been usually resident in another EU Member State Source(s) Global context: UN Recommendations on Statistics of International Migration EU context: Art. 2(b) and (f) of Regulation (EC) No 862/2007 (Migration Statistics Regulation) F G H I J Synonym(s) K Immigration Broader term(s) L migration Narrower term(s) M EU Immigration Portal Related term(s) N emigration immigrant O Euro Voc Classification 2811 migration P SL priseljevanje SV invandring Q NO innvandring KA იმიგრაცია R UK імміграція HY E S ներգաղթ T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 315
Immigration Liaison Officer (ILO) BG офицер за връзка по имиграция CS imigrační styčný důstojník Definition(s) ES oficiales de enlace de inmigración A representative designated and deployed abroad, by the competent authorities of an EU Member State, or by the Eruopean Commission or by a Union agency, in accordance with the respective legal basis, to deal with migration-related issues, also when that is only a part of their duties. ET Euroopa sisserände sideametnik Source(s) DE Verbindungsbeamter für Einwanderungsfragen EL Αξιωματικός Σύνδεσμος Μετανάστευσης EN Immigration Liaison Officer (ILO) FI maahanmuuttoalan yhteyshenkilö (ILO) FR officier de liaison «Immigration» GA Oifigeach Idirchaidrimh Inimirce (ILO) HR migracijski časnik za vezu HU bevándorlási összekötő tisztviselő IT funzionario di collegamento incaricato dell’immigrazione LT imigracijos ryšių palaikymo pareigūnas LV imigrācijas sadarbības koordinators MT Uffiċjal tal-Kollegament Responsabbli għall‑Immigrazzjoni (UKRI) NL immigratieverbindingsfunctionaris / immigratieverbindingsambtenaar PL oficer łącznikowy ds. imigracji PT oficial de ligação de imigração RO ofiţer de legătură pe probleme de imigraţie / ILO SK imigračný styčný dôstojník (ILO) SL uradnik za zvezo za priseljevanje SV sambandsman för invandring NO kontaktperson med ansvar for immigrasjon KA იმიგრაციის მეკავშირე ოფიცერი (ILO) UK Співробітник зі зв’язку з питань міграції (ILO) HY 316 ներգաղթի համար պատասխանատու պաշտոնյա Derived by EMN froom Art. 2 of Regulation (EU) 2019/1240 (Recast Immigration Liaison Officers Regulation) Synonym(s) ILO national liaison officer state liaison officer Related term(s) European Border and Coast Guard Agency (Frontex) Information and Coordination Network for Member States’ Migration Management Services (ICONet) European migration liaison officer (EMLO) European return liaison officer (EURLO) Euro Voc Classification 2811 migration Note(s) 1. Immigration Liaison Officers are posted abroad in order to establish and maintain contacts with the authorities of the host country with a view to contributing to the prevention and combating of irregular migration, the return of irregular migrants and the management of legal migration. 2.. Immigration liaison officers are to collect information concerning irregular migration for use either at operational level or at strategic level, or both. Such information could substantially contribute to the activities of European Border and Coast Guard Agengy (Frontex) relating to risk analysis; closer cooperation between different immigration liaison officers networks and Frontex should be established to that effect. As immigration liaison officers shall also be considered the liaison officers who are dealing with immigration issues as part of their duties. 3. The immigration liaison officers could be posted to the national consular authorities of EU Member States in third countries or to the relevant authorities of other EU Member States, but also to the competent authorities of third countries, as well as to international organisations for a reasonable time period to be determined by the posting EU Member State. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B immigration programme BG имиграционна програма C D Definition(s) CS imigrační program E EL μεταναστευτικό προγράμμα / πρόγραμμα μετανάστευσης Programme to facilitate migration which is organised or supported with the assistance of a government, governments or an international organisation, as opposed to spontaneous migration, which is unaided. EN immigration programme Source(s) G Related term(s) H Euro Voc Classification I DE Zuwanderungsprogramm / Einwanderungsprogramm ES programa de inmigración ET rändetoetusprogramm FI maahanmuutto-ohjelma FR programme d’immigration GA clár inimirce Developed by EMN spontaneous migration 2811 migration J HR program useljavanja HU bevándorlási program K IT programma per l’immigrazione LT imigracijos programa L LV imigrācijas programma MT Programm ta’ immigrazzjoni M NL immigratieprogramma N PL program imigracyjny PT migração assistida O RO program de imigraţie SK program prisťahovalectva / imigračný program P SL program priseljevanja SV invandringsprogram Q NO program for innvandring KA საიმიგრაციო პროგრამა R UK імміграційна програма HY F S ներգաղթի ծրագիր T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 317
immigration quota BG имиграционна квота CS imigrační kvóta DE Zuwanderungsquote / Einwanderungsquote EL ποσόστωση εισόδου μεταναστών EN immigration quota ES cuota de inmigración ET sisserände piirarv FI maahanmuuttokiintiö FR quota d’immigration GA cuóta inimirce HR useljeničke kvote HU bevándorlási kvóta IT quota (per immigrati) LT imigracijos kvota LV imigrācijas kvota MT Kwota ta’ immigrazzjoni Definition(s) A quota established for and by the country, normally for the purposes of labour migration, for the entry of immigrants. Source(s) Developed by EMN Broader term(s) labour migration quota EMN Asylum and Migration Classification 3.1 Migration for Economic Purposes Euro Voc Classification 2811 migration| 4406 employment Note(s) In the EU context, such quotas are primarily used for third-country nationals only. NL immigratiequota PL kwota imigracyjna PT quota de imigração RO cotă de imigraţie SK prisťahovalecká kvóta / imigračná kvóta SL kvota za priseljevanje SV invandringskvot NO innvandringskvote KA საიმიგრაციო კვოტა UK імміграційна квота HY 318 ներգաղթի քվոտա EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B impostor C BG измамник CS osoba zneužívající cizí identitu A person claiming the identity of another person, for instance by using the other person’s authentic identity documents. DE Betrüger EL απατεώνας Source(s) EN impostor Derived by EMN based on the Norwegian ID Centre ES impostor EMN Asylum and Migration Classification FR imposteur Euro Voc Classification HR osoba koja koristi tuđi identitet/prevarant HU imposztor IT colui che commette il reato di sostituzione di persona LV viltvārdis MT Qarrieq(a) / Impustur(a) NL bedrieger PL osoba posługująca się fałszywą tożsamością I 13.3 Crimes related to migration GA Pasadóir 2811 migration J Note(s) K 1. An impostor practises deception under an assumed identity or name or by altering their physical appearance. Imposture also applies to an authentic passport containing a false visa or stamp, or to a genuine visa in a forged passport. For further information see Frontex: Best Practice Operational Guidelines for Automated Border Control, 2016. 2. Both spellings impostor/imposter can be found, cf. Cambridge Advanced Learner’s Dictionary (2nd edition). Both versions are used by the European Union and the Schengen Member Countries. PT impostor RO impostor L M N O SK podvodník SL oseba, ki uporablja tujo identiteto P SV bedragare NO imposter Q KA თვითმარქვია R UK шахрай HY F H imposter FI toiseksi tekeytyjä / impostori E G Synonym(s) ET petis LT asmuo, kuris naudojasi svetimu dokumentu D Definition(s) կեղծարար S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 319
inadmissible application for international protection BG недопустима молба за международна закрила CS nepřípustná žádost o mezinárodní ochranu DE unzulässiger Antrag auf internationalen Schutz EL απαράδεκτη αίτηση διεθνούς προστασίας EN inadmissible application for international protection ES solicitud de protección internacional inadmisible ET vastuvõetamatu rahvusvahelise kaitse taotlus FI kansainvälistä suojelua koskeva hakemus, jota ei oteta tutkintaan FR demande de protection internationale irrecevable GA iarratas neamh-inghlactha ar chosaint idirnáisiúnta HR nedopušteni zahtjev za međunarodnu zaštitu HU elfogadhatatlan nemzetközi védelem iránti kérelem IT Domanda di protezione internazionale inammissibile LT nepriimtinas tarptautinės apsaugos prašymas (EU acquis); nepriimtinas prašymas suteikti prieglobstį LV nepieņemams starptautiskās aizsardzības pieteikums MT Applikazzjoni inaċċettabbli għall-protezzjoni internazzjonali NL niet-ontvankelijk verzoek om internationale bescherming Definition(s) An application for international protection which an EU Member State authority may decide not to examine in the following cases: (a) another EU Member State has granted international protection; (b) a country which is not an EU Member State is considered as a first country of asylum for the applicant; (c) a country which is not an EU Member State is considered as a safe third country for the applicant; (d) the application is a subsequent application, where no new elements or findings relating to the examination of whether the applicant qualifies as a beneficiary of international protection by virtue of Directive 2011/95/EU have arisen or have been presented by the applicant; or (e) a dependant of the applicant lodges an application after they have, in accordance with Art. 7(2) of Directive 2013/32/EU, consented to have their case be part of an application lodged on their behalf, and there are no facts relating to the dependant›s situation which justify a separate application. Source(s) PL niedopuszczalny wniosek o udzielenie ochrony międzynarodowej Art. 33 of Directive 2013/32/EU (Recast Asylum Procedures Directive) PT pedido inadmíssivel de proteção internacional Synonym(s) RO cerere inadmisibilă de protecție internațională formal decision SK neprípustná žiadosť o medzinárodnú ochranu EMN Asylum and Migration Classification SL nedopustna prošnja za mednarodno zaščito SV ansökan som inte kan tas upp till prövning NO asylsøknad som ikke skal realitetsvurderes (b); asylsøknad som ikkje skal realitetsvurderast (n) KA განუხილველად დატოვებული განცხადება საერთაშორისო დაცვის მოთხოვნის შესახებ UK недопустима заява про надання міжнародного захисту HY 320 միջազգային պաշտպանության ոչ ընդունելի դիմում 6.2 Procedure for international protection/Refugee status determination Euro Voc Classification 2811 migration Note(s) 1. In such cases a formal decision can be taken which means that the case was closed without an examination of the asylum claim’s substance. 2. In asylum statistics, inadmissable applications are often summarised as formal decisions. This can make comparison of national statistics on inadmissable applications challenging at EU level. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B indirect discrimination BG непряка/ косвена дискриминация CS nepřímá diskriminace DE mittelbare Diskriminierung EL έμμεση διάκριση EN indirect discrimination ES discriminación indirecta ET kaudne diskrimineerimine FI välillinen syrjintä FR discrimination indirecte GA idirdhealú indíreach HR neizravna diskriminacija HU közvetett diszkrimináció IT discriminazione indiretta LT netiesioginė diskriminacija LV netieša diskriminācija MT Diskriminazzjoni indiretta NL indirecte discriminatie PL dyskryminacja pośrednia PT discriminação indireta C D Definition(s) A situation in which an apparently neutral provision, criterion or practice would put persons of a racial or ethnic origin at a particular disadvantage compared with other persons, unless that provision, criterion or practice is objectively justified by a legitimate aim and the means of achieving that aim are appropriate and necessary. E Source(s) H Art. 2(b) of Council Directive 2000/43/EC (Racial Equality Directive) Related term(s) G I J institutional discrimination principle of equal treatment structural discrimination K EMN Asylum and Migration Classification 14.1 Political factors and impacts (such as political stability, political climate, public discourse, partly overlap with class 2) Euro Voc Classification L M N 1236 rights and freedoms RO discriminare indirectă O SK nepriama diskriminácia SL posredna diskriminacija P SV indirekt diskriminering NO indirekte diskriminering Q KA ირიბი დისკრიმინაცია R UK прихована дискримінація HY F անուղղակի խտրականություն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 321
indiscriminate violence BG безогледно насилие CS svévolné násilí DE willkürliche Gewalt EL αδιακρίτως ασκούμενη βία EN indiscriminate violence ES violencia indiscriminada ET juhuslik vägivald FI mielivaltainen väkivalta FR violence aveugle GA foréigean neamh-idirdhealaitheach Definition(s) Violence in situations of international or internal armed conflict which presents a serious and individual threat to a civilian’s life. Source(s) Art. 15 of Directive 2011/95/EU (Recast Qualification Directive) Broader term(s) serious harm EMN Asylum and Migration Classification HR opće nasilje 6.2 Procedure for international protection/Refugee status determination HU megkülönböztetés nélküli erőszak Euro Voc Classification IT Violenza indiscriminata LT nesirenkamasis smurtas (EU acquis); beatodairiškas smurtas LV plaši izplatīta vardarbība MT Vjolenza għamja NL willekeurig geweld PL przemoc na masową skalę PT violência indiscriminada RO violență generalizată SK všeobecné násilie SL vsesplošno nasilje SV urskillningslöst våld NO vilkårlig vold (b); vilkårleg vald (n) KA განურჩეველი ძალადობა UK невибіркове насильство HY 322 անխտիր բռնություն 1011 European Union law| 2811 migration Note(s) 1. The term is relevant for the purposes of determining the risk of serious harm in the context of qualification for subsidiary protection status under Art. 15(c) of Directive 2011/95/EU (Recast Qualification Directive). Indiscriminate violence refers to the source of the specific type of serious harm identified in Art. 15(c). 2. In its judgment in Elgafaji, the Court of Justice of the European Union (CJEU) has held that the term ‹indiscriminate› implies that the violence ‹may extend to people irrespective of their personal circumstances›. The Court highlighted the ‹exceptional situation› needed for Art. 15(c) to apply to civilians generally. It made clear that, for this to be the case: ‹ the degree of indiscriminate violence characterising the armed conflict taking place … such a high level that substantial grounds are shown for believing that a civilian, returned to the relevant country or, as the case may be, to the relevant region, would, solely on account of his presence on the territory of that country or region, face a real risk of being subject to the serious threat referred in Art. 15(c) of the Directive’, see CJEU C-465/07 Elgafaji vs the Netherlands. 3. United Nations High Commissioner for Refugees (UNHCR) understands the term ‘indiscriminate’ to encompass ‘acts of violence not targeted at a specific object or individual, as well as acts of violence which are targeted at a specific object or individual but the effects of which may harm others’. (See UNHCR’s study: ‘Safe at Last? Law and Practice in Selected EU Member States with respect to asylum seekers fleeing indiscriminate violence’. . EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B informal economy BG неформална икономика CS šedá ekonomika DE informelle Wirtschaft / Schattenwirtschaft EL παραοικονομία EN informal economy ES economía informal ET varimajandus FI epävirallinen talous FR économie informelle GA geilleagar neamhfhoirmiúil HR neslužbeno gospodarstvo C D Definition(s) E All economic activities by workers and economic units that are -in law or in practice -not covered or insufficiently covered by formal arrangements. F Source(s) Para. 3 of ILO Resolution concerning Decent Work and the Informal Economy, 2002 G Synonym(s) H black market clandestine employment I Related term(s) HU informális gazdaság informal employment informal sector J IT economia informale EMN Asylum and Migration Classification K LT šešėlinė ekonomika NL informele economie 4.4 Reception and Accommodation of Applicants for international protection and other refugees| 14.2 Economic factors and impacts (such as brain drain/gain, employment/ unemployment, labour market, economic growth, dumping) PL gospodarka nierejestrowana Euro Voc Classification LV neformālā ekonomika MT Ekonomija informali PT economia informal SL neformalno gospodarstvo / siva ekonomija SV informell ekonomi NO uformell økonomi / parallell økonomi KA არაფორმალური ეკონომიკა N Note(s) O 1. Activities within the informal economy are not covered by law, which means that they are operating outside of the formal reach of relevant legislation; or they are not covered in practice, which means that, although they are operating within the formal reach of the law, the law is not applied or not enforced, or the law discourages compliance because it is inappropriate, burdensome or imposes excessive costs. 2. This applies to third-country nationals, too. UK тіньова економіка HY M 4406 employment RO economie informală SK tieňová ekonomika / šedá ekonomika L P Q R ոչ ֆորմալ տնտեսություն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 323
Information and Coordination Network for Member States’ Migration Management Services (ICONet) BG Мрежа за информация и координация на службите за управление на миграцията на държавите членки CS Informační a koordinační síť pro služby řízení migrace členských států DE Informations- und Koordinierungsnetz für die Migrationsbehörden der EU-Mitgliedstaaten EL Δικτύου Πληροφοριών και Συντονισμού των Υπηρεσιών Διαχείρισης της Μετανάστευσης των κρατών μελών EN Information and Coordination Network for Member States’ Migration Management Services (ICONet) ES ICONet ET liikmesriikide migratsiooniteenistuste info-ja koordineerimisvõrgustik FI Tieto- ja koordinointiverkosto maahanmuuton hallinnasta vastaavia jäsenvaltioiden viranomaisia varten (ICONet) FR Réseau d’information et de coordination sécurisé connecté à l’internet pour les services des États membres chargés de la gestion des flux migratoires (ICONet) LT Informacijos ir koordinavimo tinklas, skirtas valstybių narių migracijos valdymo tarnyboms LV Informācijas un koordinācijas tīkls dalībvalstu migrācijas pārvaldes dienestiem MT Netwerk ta’ Informazzjoni u Koordinazzjoni għasServizzi dwar Ġestjoni ta’ Migrazzjoni fl-Istati Membri / ICONet NL Informatie- encoördinatienetwerk voor de migratiebeheersdiensten van de lidstaten PL ICONet / no usual translation PT ICONet RO Reţeaua de informare şi coordonare a serviciilor de management al migraţiei din statele membre (ICONet) SK Informačná a koordinačná sieť pre služby riadenia migrácie členských štátov (ICONet) SL Informacijsko in usklajevalno omrežje, namenjeno službam držav članic za migracije SV ICONet NO ICONet KA ევროკავშირის წევრი ქვეყნების მიგრაციის სამსახურთა საინფორმაციო და საკოორდინაციო ქსელი (ICONet) GA ICONet HR Informacijska i koordinacijska mreža za migracijske službe država članica (ICONet) HU információs és koordinációs hálózat a tagállamok migrációigazgatási szolgálatai részére IT Rete di Informazione e Coordinamento per i Servizi di Gestione dell’Immigrazione degli Stati Membri / ICONet 324 UK Інформаційна та координаційна мережа для служб управління міграцією держав-членів (ICONet) HY EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Անդամ պետությունների միգրացիայի կառավարման ծառայությունների տեղեկատվական և համակարգման ցանց
A B C D E Definition(s) F A secure web-based information and coordination network for the rapid information exchange between EU Member States on irregular migration flows and phenomena, and the return of illegal residents. G H Source(s) Derived by EMN from Art. 1 of Council Decision 2005/267/EC (Decision on an Information and Coordination Network for Member States’ Migration Management Services) I J Synonym(s) ICONet K Related term(s) European Border and Coast Guard Agency (Frontex) Immigration Liaison Officer (ILO) mutual information mechanism L M EMN Asylum and Migration Classification 13. Irregular Migration N Euro Voc Classification 2811 migration O Note(s) P 1. The ICONet was established in 2005 within the framework of the Council’s comprehensive plan to combat illegal immigration and trafficking of human beings. 2. The elements for information exchange shall include at least the following: (a) early warning system on irregular immigration and facilitator networks; (b) network of immigration liaison officers (ILOs); (c) information on the use of visas, borders and travel documents in relation to illegal immigration; and (d) return-related issues. Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 325
inhuman treatment or punishment BG нечовешко отношение или наказание CS nelidské zacházení nebo trest DE unmenschliche Behandlung oder Bestrafung EL απάνθρωπη µεταχείριση ή τιµωρία EN inhuman treatment or punishment ES pena o trato inhumano ET ebainimlik kohtlemine või karistamine FI epäinhimillinen kohtelu tai rangaistus FR peine ou traitement inhumain GA íde nó píonós mídhaonna HR nečovječno postupanje ili kažnjavanje HU embertelen bánásmód vagy büntetés IT Trattamento inumano o pena inumana Definition(s) Ill-treatment which is premeditated and applied for hours at a stretch and causing either actual bodily injury or intense physical and mental suffering. Source(s) ECtHR, Kudla vs Poland Application no. 30210/96 Related term(s) degrading treatment or punishment torture EMN Asylum and Migration Classification 1. Framework Concepts on Migration (including root causes of migration Euro Voc Classification 1236 rights and freedoms LT nežmoniškas elgesys ar baudimas LV necilvēcīga rīcība vai sodīšana MT Trattament jew kastig inuman / piena inumana NL onmenselijke behandeling of bestraffing PL nieludzkie traktowanie lub kara PT pena ou tratamento desumanos RO tratament inuman sau pedeapsă SK neľudské zaobchádzanie alebo trestanie SL nečloveško ravnanje ali kaznovanje SV omänsklig behandling eller bestraffning NO umenneskelig behandling eller straff (b); umenneskeleg handsaming eller straff (n) KA არაადამიანური მოპყრობა ან სასჯელი UK нелюдське поводження чи покарання HY 326 անմարդկային վերաբերմունք կամ պատիժ Note(s) 1. Prohibition on torture or inhuman or degrading treatment or punishment is recognised as a right of paramount significance under international human rights law and set out in all major international instruments dealing with civil and political rights, such as in Art. 3 of the European Convention on Human Rights (ECHR). The prohibition, contained in Art. 3 of the ECHR is the only Convention prohibition that is not subject to any limitations or derogations. 2. While the UN Convention against Torture and Other Cruel, Inhuman or Degrading Treatment or Punishment (UNCAT) provides a definition of torture, there is no universally accepted definition of inhuman and degrading treatment or punishment. The case law of the European Court of Human Rights (ECtHR) provides at least a source of guidance even though the decision practice of the Court has changed over the time. On the basis of the degree of severity of ill-treatment the Court distinguished and defined three concepts prohibited by Art.3: (i) torture, (ii) inhuman treatment or punishment and (iii) degrading treatment or punishment. Further, the Court emphasized in the Selmouni vs. France judgement of 28 July 1999 that the hierarchy distinguishing the three categories of ill-treatment is fluid in nature and has to be assessed in harmony with societal pogress. 3. The concept of inhuman treatment and punishment is the least developed of the three concepts (degrading treatment, inhuman treatment, torture) for different forms of ill-treatment. 4. It is often difficult to identify the exact boundaries between the different forms of ill-treatment as this requires an assessment about degrees of suffering that may depend on the particular circumstances of the case and the caracteristics of the particular victim. According to the case law of the ECtHR various components can determine whether a particular treatment constitutes torture or inhuman or degrading treatment or punishment: the gravity of the treatment, the intentional infliction of the treatment, the severity of the pain, the arbitrariness of the violence, the prohibited purpose, the duration of the treatment and the level of cruelty of the act. The Court did not classify these examples as exhaustive, the prohibited purpose criterion of the torture definition of the UN Convention against Torture and Other Cruel, inhuman or Degrading Treatment or Punishment (UNCAT) is not the only decisive factor. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B integration BG интеграция CS integrace DE Integration EL ένταξη EN integration ES integración ET lõimumine / integratsioon FI kotoutuminen FR intégration C D Definition(s) E In the EU context, a dynamic, two-way process of mutual accommodation by all immigrants and residents of EU Member States. F Source(s) Action 1, section 2 of European Commission: Communication on a Common Agenda for Integration, COM(2005) 389 final Narrower term(s) G H I HU integráció Common Basic Principles European Website on Integration Handbook on Integration National Contact Points on Integration IT integrazione Related term(s) K GA imeascadh HR integracija LT integracija LV integrācija MT Integrazzjoni NL integratie PL integracja PT integração RO integrare SK integrácia SL integracija / vključevanje SV integration NO integrering KA ინტეგრაცია UK інтеграція HY J adaptation host society reintegration L EMN Asylum and Migration Classification M Euro Voc Classification N 9. Integration 2811 migration O Note(s) 1. Art. 79(4) of the TFEU gives the legal base for Union activities on integration. The promotion of fundamental rights, non-discrimination and equal opportunities for all are key integration issues. 2. At EU level, integration policy is developed within the framework of Common Basic Principles - CBP (of which the broad definition above is the first one). 3. For more information, see European Website on Integration. P Q R ինտեգրում S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 327
integration indicators BG показатели за интеграция CS indikátory integrace DE Integrationsindikatoren EL δείκτες ένταξης EN integration indicators ES Indicadores de integración Definition(s) Benchmarks used to measure the integration of migrants in specific policy areas, such as employment, education, social inclusion and active citizenship. Source(s) FI kotoutumisen indikaattorit Derived by EMN from the European Website on Integration: Using EU Indicators of Immigrant Integration, August 2013. FR indicateurs d’intégration Synonym(s) ET integratsiooni indikaatorid GA Zaragoza indicators HR pokazatelji integracije Broader term(s) HU integrációs indikátorok integration IT indicatori di integrazione Related term(s) LT integracijos rodikliai LV integrācijas indikatori MT Indikaturi tal-integrazzjoni NL Integratie-indicatoren PL wskaźniki integracji PT indicadores de integração RO indicatori de integrare SK ukazovatele integrácie / integračné ukazovatele SL kazalniki integracije / kazalniki vključevanja SV integrationsindikatorer NO integreringsindikatorer KA ინტეგრაციის ინდიკატორები UK показники інтеграції HY 328 Common Basic Principles Integration Monitoring EMN Asylum and Migration Classification 9.2 Integration indicators Euro Voc Classification 2811 migration| 2826 social affairs Note(s) 1. The Zaragoza Declaration on Integration adopted in 2010 agreed on a set of common indicators in the policy areas mentioned in the definition, additional indicators (such as health) were introduced later. 2. Eurostat reports include statistics monitoring the core Zaragoza indicators and other indicators such as indicators for employment: the share of employees who are overqualified for their jobs; self-employment. 3. For more information see Final Report on Using EU Indicators of Immigrant Integration, August 2013. ինտեգրման ցուցանիշներ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B integration programme BG програма за интегриране CS integrační program DE Integrationsprogramm EL πρόγραμμα (κοινωνικής) ένταξης EN integration programme ES Programa de integración ET integratsiooni programm FI kotoutumisohjelma FR programme d’intégration GA C D Definition(s) Set of measures put in place by the State and/or civil society organisations to support the integration of legally residing migrants/third-country nationals into the host society. E Source(s) G Broader term(s) H Narrower term(s) I Developed by EMN integration F HU integrációs program civic orientation course mandatory integration programme voluntary integration programme IT piano di integrazione EMN Asylum and Migration Classification K Euro Voc Classification L HR program integracije LT integracijos programa LV integrācijas programma MT J 9.1 Integration measures 2811 migration| 2826 social affairs M NL Inburgeringscursus / Inburgeringstraject PL program integracyjny PT programa de integração RO program de integrare SK integračný program / program integrácie SL program vključevanja / program integracije SV integrationsprogram / etableringsinsatser NO integreringsprogram KA საინტეგრაციო პროგრამა UK програма інтеграції HY ինտեգրացման ծրագիր Note(s) 1. In some EU Member States integration programmes are mandatory whereas in others they are voluntary. 2. Mandatory programmes may take different forms, such as tests or classes or long-term commitment, and are made compulsory by law or regulation. If third-country nationals do not comply with mandatory integration measures or conditions, access to certain benefits/services can be limited or certain sanctions may be imposed (such as refusal to issue a residence permit or to renew it, the withdrawal of financial or social support). 3. Voluntary programmes may be of the same nature as mandatory measures and conditions. However, there is no obligation for third-country nationals to engage in such programmes and there are no sanctions weighing on the residence permit or status where persons do not properly attend integration programmes. Incentives may have been introduced to motivate third-country nationals to participate in integration programmes. 4. In some EU Member States such integration programmes are free of charge or publicly funded, in others participants have to pay on their own. 5. Some EU Member States offer pre-departure integration measures targeted specifically at applicants of international protection. 6. Civic orientation courses are often part of the integration programme. N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 329
intercultural dialogue BG междукултурен диалог CS mezikulturní dialog DE interkultureller Dialog EL διαπολιτισμικός διάλογος EN intercultural dialogue ES diálogo intercultural Definition(s) An open and respectful exchange of views between individuals and groups with different ethnic, cultural, religious and linguistic backgrounds and heritage on the basis of mutual understanding and respect. Source(s) ET kultuuridevaheline dialoog Section 1.4 of Council of Europe: White Paper on Intercultural Dialogue, May 2008 FI kulttuurienvälinen vuoropuhelu Narrower term(s) FR dialogue interculturel GA idirphlé idirchultúrtha HR interkulturni dijalog HU kultúrák közötti párbeszéd IT dialogo interculturale cultural mediator Related term(s) cultural diversity EMN Asylum and Migration Classification LT tarpkultūrinis dialogas 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) LV starpkultūru dialogs Euro Voc Classification MT Djalogu interkulturali NL interculturele dialoog PL dialog międzykulturowy PT diálogo intercultural RO dialog intercultural SK medzikultúrny dialóg / interkultúrny dialóg SL medkulturni dialog SV interkulturell dialog 2811 migration| 2831 culture and religion Note(s) 1. Intercultural dialogue has long been a principle supported by the European Union and its institutions. The year 2008 was designated ‘European Year of Intercultural Dialogue’ (EYID) by the European Parliament and the EU Member States. It aimed to draw the attention of people in Europe to the importance of dialogue within diversity and between diverse cultures. 2. For more information, see Evaluation of the European Year of Intercultural Dialogue, 2008, (COM/2010/0361 final) . NO interkulturell dialog KA კულტურათაშორისი დიალოგი UK міжкультурний діалог HY 330 միջմշակութային երկխոսություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 331
Intergovernmental Consultations on Migration, Asylum and Refugees (IGC) BG Междуправителствени консултации по миграция, убежище и бежанци LV Starpvaldību konsultācijas par migrācijas, patvēruma un bēgļu jautājumiem CS Mezivládní konzultace k migraci, azylu a uprchlictví MT Konsultazzjonijiet Intergovernattivi fuq Migrazzjoni, Ażil u Rifuġjati DE Zwischenstaatliche Beratungen über Migration, Asyl und Flüchtlinge EL Οργανισμός Διακυβερνητικών Διαβουλεύσεων για τη μετανάστευση, το άσυλο και τους πρόσφυγες EN Intergovernmental Consultations on Migration, Asylum and Refugees (IGC) ES Consultas Intergubernamentales sobre Asilo, Refugio y Migración ET valitsustevahelised konsultatsioonid rände-, varjupaiga- ja pagulasteemal FI IGC (Euroopan, Pohjois-Amerikan ja Australian turvapaikka-, pakolais- ja siirtolaispolitiikkoja käsittelevä hallitustenvälinen foorumi) NL Intergouvernementeel overleg inzake migratie, asiel en vluchtelingen PL Międzyrządowe Konsultacje nt. Migracji, Azylu i Uchodźców PT Consultas Intergovernamentais sobre Migrações, Asilo e Refugiados RO Consultări interguvernamentale cu privire la migrație, azil și refugiați SK Medzivládne konzultácie o migrácii, azyle a utečencoch (IGC) SL Medvladna posvetovanja o migracijah, azilu in beguncih FR Consultations intergouvernementales sur les politiques d’asile, de réfugiés et de migrations SV IGC / Intergovernmental Consultations on Migration, Asylum and Refugees GA Comhairliúcháin Idir-Rialtasacha maidir le hImirce, Tearmann agus Dídeanaithe NO Flernasjonal informasjonsutveksling om migrasjons, asyl- og flyktningspørsmål HR Međuvladine konzultacije (MVK) o migracijama, azilu i izbjeglicama KA მთავრობათაშორისი კონსულტაციები HU Kormányközi egyeztetés a migrációról, menekültügyről és menekültekről IT Consultazioni Inter-Governative in materia di Immigrazione, Asilo e Rifugiati მიგრაციის, თავშესაფრისა და ლტოლვილთა საკითხებზე (IGC) UK Міжурядові консультації з питань міграції, притулку та біженців (IGC) HY LT Tarpvyriausybinės konsultacijos migracijos, prieglobsčio ir pabėgėlių klausimais 332 EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Միգրացիայի, ապաստանի և փախստականների վերաբերյալ միջկառավարական խորհրդատվություններ
A B C Definition(s) An informal, non-decision making forum for intergovernmental information exchange and policy debate on issues of relevance to the management of international migratory flows, which brings together the participating states, the United Nations High Commissioner for Refugees (UNHCR), the International Organization for Migration (IOM) and the European Commission. Source(s) Website of the IGC Synonym(s) IGC Related term(s) European Asylum Support Office (EASO) International Organization for Migration (IOM) United Nations High Commissioner for Refugees (UNHCR) Euro Voc Classification 2811 migration D Note(s) 1. The starting point for the IGC was a conference held in May 1985 under the auspices of the UNHCR. While historically focused on asylum issues, IGC has moved towards greater discussion and exchange of data on general migration policies since 2006. 2.The IGC’s work is organised around six broad portfolios, each led by a working group which meets twice yearly: ƒ Admission, Control and Enforcement covers all policy and practical aspects along the enforcement continuum including pre-entry, travel, admission, in-country controls, detention, return and readmission for both regular and irregular immigration flows, including smuggling of migrants and trafficking in human beings. ƒ Asylum and Refugees focuses on the broad range of asylum, refugee and international protection matters, from administrative case processing and refugee status determination to strategic policy issues. ƒ Country of Origin Information (COI) covers all policy and practical aspects of country of origin information, including COI for asylum cases, protection, resettlement, enforcement and immigration, and effective methodology and practices in COI work. ƒ Immigration covers the range of legal migration pathways, from labour migration to students and family migration, as well as cross-cutting issues, such as drivers of legal migration, and the nexus between immigration and integration policies and practices. ƒ Integration focuses on policy and practice around settlement and integration, including issues related to language acquisition, labour market inclusion, civic participation, social cohesion, and citizenship. ƒ Technology is cross-cutting and provides a support function to other IGC portfolios by covering all technologies being employed in the areas of regular and irregular migration. 3. As part of its comprehensive approach, the IGC undertakes a range of multi-disciplinary activities based on the priorities of participating states. This includes exploration of emerging themes or country-specific issues through in-person or virtual workshops, expert networks, and site visits. For more information see the IGC website. E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 333
internal EU border BG вътрешна граница на ЕС CS vnitřní hranice EU DE EU-Binnengrenze EL εσωτερικά σύνορα της ΕΕ EN internal EU border ES frontera interior (UE) Definition(s) The parts of a Schengen Member States’ border, including land borders, river and lake borders, sea borders and their airports, river ports, sea ports and lake ports. Source(s) ET Euroopa Liidu sisepiir Derived by EMN from Art. 2(1) of Regulation (EU) 2016/399 (Schengen Borders Code) FI EU:n sisäraja Synonym(s) FR frontière intérieure de l’UE GA teorainn inmheánach AE internal border internal Schengen border HR unutarnje granice EU-a Related term(s) HU az EU belső határa IT frontiera interna UE LT ES vidaus siena LV ES iekšējā robeža MT Konfini (Il-) interni / Fruntiera (Il-) interna tal-UE NL EU binnengrens PL granica wewnętrzna UE PT fronteira interna RO Frontieră internă a UE SK vnútorná hranica EÚ SL notranja meja EU SV inre gräns NO grense mellom Schengen-medlemsland KA ევროკავშირის შიდა საზღვარი UK внутрішній кордон ЄС HY 334 ԵՄ ներքին սահմաններ border control external EU border irregular entry legal entry refusal of entry Schengen Borders Code EMN Asylum and Migration Classification 6.1.1 Border control| 6.1.3 Schengen governance Euro Voc Classification 1011 European Union law| 2811 migration Note(s) 1. IE does not participate in the Schengen Area. 2. BG and RO are Schengen candidate countries, they are currently in the process of joining the Schengen Area and already applying the Schengen acquis to a large extent. 3. IS, LI, NO and CH are also Schengen Member States, although they are not EU Member States. 4. For updated information on membership to the Schengen Area, see the DG Migration and Home Affairs website. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B internal protection BG вътрешна закрила CS vnitrostátní ochrana DE interner Schutz EL εγχώρια προστασία EN internal protection ES protección interna ET riigisisene kaitse FI suojelu alkuperämaassa FR protection à l’intérieur du pays GA cosaint inmheánach HR unutarnja zaštita C D Definition(s) The concept that an applicant is not in need of international protection if in a part of the country of origin, they (a) have no well-founded fear of being persecuted or are not at real risk of suffering serious harm; or (b) have access to protection against persecution or serious harm; and they can safely and legally travel to and gain admittance to that part of the country and can reasonably be expected to settle there. Source(s) E F G H I HU belső védelem Derived by EMN from Art. 8 of Directive 2011/95/ EU (Recast Qualifiation Directive) J IT protezione all’interno del paese di origine Synonym(s) K LT vidaus apsauga LV iekšējā aizsardzība MT Protezzjoni interna NL binnenlandse bescherming PL ochrona wewnętrzna PT proteção interna RO Protecția în interiorul țării SK vnútroštátna ochrana / vnútorná ochrana SL notranja zaščita SV internt skydd / internt flyktalternativ NO intern beskyttelse (b); internt vern (n) KA ქვეყნის შიგნით დაცვა UK внутрішній захист HY ներքին պաշտպանություն internal flight alternative internal protection alternative internal relocation alternative IFA IPA L M Related term(s) N EMN Asylum and Migration Classification O Euro Voc Classification P international protection 4. International Protection and other Types of Protection 1011 European Union law| 2811 migration Q Note(s) The assessment whether an internal protection alternative is available in the country of origin is part of the assessment of the application of international protection and has to take into account all the circumstances of the individual case. This assessment is to be made in the context of the conditions in the place of relocation (including basic human rights, security conditions, socio-economic conditions, accommodation, access to health care facilities), in order to determine the impact on that individual of settling in the proposed place of relocation and whether the individual could live a relatively normal life without undue hardship. For further information see UNHCR: Guidelines on international protection: Internal Flight or Relocation Alternative within the Context of Article 1A(2) of the 1951 Convention and/or 1967 Protocol relating to the Status of Refugees, July 2003. R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 335
internally displaced person BG вътрешно разселено лице CS vnitřně vysídlená osoba DE Binnenvertriebener EL εσωτερικώς εκτοπισθείς (EL); εκτοπισθείς (CY) EN internally displaced person ES población desplazada internamente ET riigisiseselt ümberasustatud isik / riigisisene põgenik FI maan sisällä siirtymään joutunut henkilö FR personne déplacée à l’intérieur de son propre pays GA duine easáitithe de thír HR interno raseljene osobe HU belső menekült IT sfollato interno LT viduje perkeltasis asmuo LV iekšzemē pārvietota persona Definition(s) A person or groups of persons who has been forced or obliged to flee or to leave their homes or places of habitual residence, in particular as a result of or in order to avoid the effects of armed conflict, situations of generalised violence, violations of human rights or natural or human-made disasters, and who have not crossed an internationally recognised State border. Source(s) Art. 2 of UN Guiding Principles on Internal Displacement, 1998. Synonym(s) IDP Broader term(s) displaced person Related term(s) NL in eigen land ontheemd persoon de facto refugee environmentally displaced person forced migrant PL osoba wewnętrznie przesiedlona EMN Asylum and Migration Classification MT Persuna sfollata internament / f’pajjiżha stess PT deslocado interno RO persoană strămutată în interiorul țării / persoană strămutată intern SK vnútorne vysídlená osoba 1. Framework Concepts on Migration (including root causes of migration Euro Voc Classification 2811 migration SL notranje razseljena oseba SV internflykting NO internt fordrevet person (b); internt fordriven person (n) Note(s) For more information, see the Website of the Internal Displacement Monitoring Centre (IDMC). KA (ქვეყნის შიგნით) იძულებით გადაადგილებული პირი UK внутрішньо переміщена особа HY 336 ներքին տեղահանված անձ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
International Civil Aviation Organisation (ICAO) format BG Формат на Международната организация за гражданска авиация A B C D Definition(s) CS Formát stanovený Mezinárodní organizací pro civilní letectví DE Format der Internationalen Zivilluftfahrt-Organisation / Format der Zivilluftfahrt-Organisation EL μορφότυπος Διεθνούς Οργάνωσης Πολιτικής Αεροπορίας EN International Civil Aviation Organisation (ICAO) format ES formato de la organización de aviación civil internacional Specifications set out by the International Civil Aviation Organisation (ICAO) in relation to machine readable travel documents, including passports and visas. E Source(s) G F Derived by EMN from ICAO Doc 9303 Machine Readable Travel Documents Seventh Edition, 2015, Part 1. Synonym(s) ICAO format I EMN Asylum and Migration Classification ET Rahvusvahelise Tsiviillennun-duse Organisatsiooni spetsifikatsioonid 6.1 Entry Conditions and Procedures J Euro Voc Classification FI Kansainvälisen siviili-ilmailujärjestön määrittelyt koneluettavista matkustusasiakirjoista FR format de l’Organisation de l’aviation civile internationale (OACI) 2811 migration K Note(s) L 1. The specifications relate to both machine readable travel documents and electronic machine readable travel documents which include the capability of being used for biometric identification. 2. The ICAO format is followed by all EU/Schengen Member States. GA HR format Organizacije međunarodnog civilnog zrakoplovstva (ICAO) H M HU Nemzetközi Polgári Repülési Szervezet (ICAO) formátum N IT Formato Standard ICAO – Organizzazione Internazionale Aviazione Civile O LT Tarptautinės civilinės aviacijos organizacijos reikalavimai P LV Starptautiskās Civilās aviācijas organizācijas forma Q MT Format (Il-) tal-Organizzazzjoni tal-Avjazzjoni Ċivili Internazzjonali R NL Internationale Burgerluchtvaartorganisatie format PL format Międzynarodowej Organizacji Lotnictwa Cywilnego S PT Formato estabelecido pela Organização da Aviação Civil Internacional T RO formatul Organizației Aviației Civile Internaționale (OACI) U SK formát Medzinárodnej organizácie pre civilné letectvo (ICAO) V SL format Mednarodne organizacije za civilno letalstvo SV Internationella civila luftfartsorganisationens format W NO Format fastlagt av Den internasjonale organisasjonen for sivil luftfart X KA სამოქალაქო ავიაციის საერთაშორისო Y ორგანიზაციის (ICAO) ფორმატი UK Формат Міжнародної організації цивільної авіації (ІКАО) HY Z Քաղաքացիական ավիացիայի միջազգային կազմակերպության ձևաչափ EMN ASYLUM AND MIGRATION GLOSSARY 10.0 337
International Organization for Migration (IOM) BG Международна организация по миграция CS Mezinárodní organizace pro migraci DE Internationale Organisation für Migration EL Διεθνής Οργανισμός Μετανάστευσης EN International Organization for Migration (IOM) ES Organización Internacional para las Migraciones ET Rahvusvaheline Migratsiooniorganisatsioon FI Kansainvälinen siirtolaisuusjärjestö FR Organisation internationale pour les migrations (OIM) GA an Eagraíocht Idirnáisiúnta um Imirce HR Međunarodna organizacija za migracije (IOM) HU Nemzetközi Migrációs Szervezet IT Organizzazione Internazionale per le Migrazioni Definition(s) An intergovernmental organisation in the field of migration dedicated to ensuring the orderly and humane management of migration, to promote international cooperation on migration issues, to assist in the search for practical solutions to migration problems and to provide humanitarian assistance to migrants in need, be they refugees, displaced persons or other uprooted people. Source(s) Website of the International Organisation of Migration Synonym(s) IOM Related term(s) LT Tarptautinė migracijos organizacija United Nations High Commissioner for Refugees (UNHCR) LV Starptautiskā Migrācijas organizācija EMN Asylum and Migration Classification MT Organizzazzjoni (L-) Internazzjonali għall-Migrazzjoni NL Internationale Organisatie voor Migratie 1. Framework Concepts on Migration (including root causes of migration PL Międzynarodowa Organizacja do Spraw Migracji Euro Voc Classification PT Organização Internacional para as Migrações RO Organizaţia Internaţională pentru Migraţie SK Medzinárodná organizácia pre migráciu (IOM) SL Mednarodna organizacija za migracije SV International Organization for Migration / Internationella organisationen för migration 2811 migration| 76 International Organisations Note(s) 1. The agency was created in 1951. 2. It is one of the main inter-governmental organisations in the field of migration and works closely with governmental, intergovernmental and non-governmental partners. 3. For further information, see the website of IOM. NO Den internasjonale migrasjonsorganisasjonen KA მიგრაციის საერთაშორისო ორგანიზაცია (IOM) UK Міжнародна організація з міграції (МОМ) HY 338 Միգրացիայի միջազգային կազմակերպություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B international protection BG международна закрила CS mezinárodní ochrana C D Definition(s) ET rahvusvaheline kaitse In the global context, the actions by the international community on the basis of international law, aimed at protecting the fundamental rights of a specific category of persons outside their countries of origin, who lack the national protection of their own countries. In the EU context, protection that encompasses refugee status and subsidiary protection status. FI kansainvälinen suojelu Source(s) DE internationaler Schutz EL διεθνής προστασία EN international protection ES protección (internacional) HR međunarodna zaštita Global context: Derived by EMN from UNHCR Master Glossary of Terms EU context: Derived by EMN from Art. 2(a) of Directive 2011/95/EC (Recast Qualification Directive) HU nemzetközi védelem Broader term(s) FR protection internationale GA cosaint idirnáisiúnta IT protezione internazionale LT tarptautinė apsauga (EU acquis); prieglobstis LV starptautiskā aizsardzība MT Protezzjoni internazzjonali NL internationale bescherming PL ochrona międzynarodowa PT proteção internacional RO protecţie internaţională SK medzinárodná ochrana SL mednarodna zaščita SV internationellt skydd NO internasjonal beskyttelse (b); internasjonalt vern (n) KA საერთაშორისო დაცვა UK міжнародний захист HY միջազգային պաշտպանություն protection E F G H I J K Narrower term(s) refugee status subsidiary protection L Related term(s) M asylum Geneva Refugee Convention and Protocol humanitarian protection temporary protection United Nations High Commissioner for Refugees (UNHCR) N O EMN Asylum and Migration Classification P Euro Voc Classification Q 4.1 International protection 1011 European Union law| 2811 migration R Note(s) 1. An essential element of the common asylum policy of the European Union and the Common European Asylum System (CEAS) is the concept of international protection. It is based, on the one hand, on the full and inclusive application of the Geneva Refugee Convention and Protocol, thus ensuring that nobody is sent back to persecution, i.e. maintaining the principle of non-refoulement, and on the other hand complimented by subsidiary protection for those people not falling under the scope of the Geneva Convention but nevertheless in need of protection from threats to life, freedom or physical integrity arising from armed conflict, serious public disorder, or different situations of violence. 2. The new form of subsidiary protection was introduced on the European Council meeting, 15 and 16 October 1999 in Tampere as a reaction to the Yugoslavian wars. For more information see the Presidency Conclusions. 3. Directive 2011/95/EU (Recast Qualification Directive) as the cornerstone of the CEAS sets out the criteria for applicants to qualify for refugee status or subsidiary protection status and sets out the rights afforded to persons who have been granted one of those statuses. They include the right to a residence permit, travel document, access to employment, access to education, social welfare, healthcare, access to accommodation, access to integration facilities, as well as specific provisions for children and vulnerable persons. The directive allows EU Member States to put in place or to keep more favourable standards than those set out in its provisions. 4. The concept of international protection within the meaning of Directive 2011/95/EU (Recast Qualification Directive) does not lead to the granting of an ‘international protection status’ but either to refugee status or to subsidiary protection status. EMN ASYLUM AND MIGRATION GLOSSARY 10.0 339 S T U V W X Y Z
interpreter BG устен преводач CS tlumočník DE Dolmetscher EL διερμηνέας EN interpreter ES Intérprete ET tõlk FI tulkki FR interprète GA ateangaire HR prevoditelj HU tolmács IT interprete LT vertėjas LV tulks MT Interpretu NL Tolk PL tłumacz PT intérprete RO interpret SK tlmočník SL tolmač SV tolk NO tolk KA თარჯიმანი UK Перекладач HY 340 թարգմանիչ Definition(s) In the migration context,a professional who is expected to convert oral communication from a source language (language/s of the country of origin of a migrant) to a target language (language of the host country) and vice versa to ensure appropriate communication between migrants and staff of public authorities in particular who do not speak the same language. Source(s) Developed by EMN. Related term(s) cultural mediator EMN Asylum and Migration Classification 6.3.5 Interpretation Services Euro Voc Classification 2811 migration| 32 Education and Communications Note(s) 1. The role of interpreters in asylum and migration procedures is expected to provide accurate and complete message transfer into the target language and vice versa preserving the content and intent of the source message without omission or distortion. 2. Art. 15(c) of Directive 2013/13/EU (Recast Asylum Procedures Directive) set standards for interpreters in international protection procedures and requires to select an interpreter who is able to ensure appropriate communication between the applicant and the person who conducts the interview. The communication shall take place in the language preferred by the applicant unless there is another language which they understand and in which they are able to communicate clearly. Wherever possible, EU Member States shall provide an interpreter of the same sex if the applicant so requests, unless the determining authority has reasons to believe that such a request is based on grounds which are not related to difficulties on the part of the applicant to present the grounds of their application in a comprehensive manner. 3. UNHCR has published guidelines for interpreters in asylum procedures, see Handbook for Interpreters in Asylum Procedures, 2017. 4. Interpretation and cultural mediation are two facets of interpersonal communication. The key difference between a (linguistic) interpreter and a cultural mediator is that an interpreter passively conveys the messages from one language to another and as accurately as possible, whereas a cultural mediator focuses on the complex and at the same time interdisciplinary character of communication by explaining the meaning of behaviours, symbols and rituals from one culture to people from another culture. Furthermore, interpretation is a registered profession with all legal rights therefore a professional interpreter has to follow certain standards and a code of conduct. For more information see: Erasmus+and Train Intercultural Mediators for a Multicultural Europe: Research report on intercultural mediation for immigrants in Europe, 2015. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B intra-corporate transferee BG вътрешнокорпоративен трансфер C D Definition(s) CS vnitropodnikově převáděný pracovník DE unternehmensintern transferierter Arbeitnehmer (EU acquis, AT, LU); innerbetrieblich versetzte Person (DE) EL ενδοϋπηρεσιακώς µετατιθέµενος EN intra-corporate transferee ES trabajador transnacional A third-country national subject to a temporary secondment from an undertaking established outside the territory of a EU Member State and to which the third-country national is bound by a work contract to an entity belonging to the undertaking or to the same group of undertakings which is established inside this territory. Source(s) E F G H FR personne faisant l’objet d’un transfert temporaire intragroupe Derived from Arts. 3(b) and 3(c) of Directive 2014/66/ EU (Directive on the entry and residence of third-country nationals in the framework of an intra-corporate transfer) GA aistrí ionchorparáideach EMN Asylum and Migration Classification J Euro Voc Classification K ET ettevõttesisene üleviimine FI sisäisen siirron saanut työntekijä 3.1 Migration for Economic Purposes HR osoba premještena unutar društva HU vállalaton belül áthelyezett személy 2811 migration| 4406 employment IT lavoratore straniero distaccato (persona trasferita all’interno della stessa società in un altro paese) L Note(s) LT bendrovės viduje perkeliamas asmuo (EU acquis); įmonės viduje perkeltas užsienietis LV uzņēmuma ietvaros pārcelts darbinieks / uzņēmuma iekšienē nosūtīts darbinieks MT Ħaddiem trasferit minn post għal ieħor tal‑istess kumpanija / Trasferiment intra-korporattiv ta’ ħaddiem I The World Trade Organisation’s (WTO) General Agreement on Trade in Services (GATS), liberalises trade in services, including the temporary movement of natural persons as service suppliers. Mode 4 refers to the presence of persons of one WTO member in the territory of another for the purpose of providing a service. It does not concern persons seeking access to the labour market in the host member, nor does it affect measures regarding citizenship, residence or employment on a permanent basis. For more information, see the website of the World Trade Organization. NL binnen een onderneming overgeplaatste persoon M N O P PL pracownik przenoszony wewnątrz przedsiębiorstwa Q PT pessoas transferidas temporariamente pela empresa RO transferat intra-corporaţie R SK pracovník presunutý v rámci spoločnosti SL oseba, premeščena znotraj podjetja SV företagsinternt förflyttad person S NO utstasjonert arbeidstaker (b); utstasjonert arbeidstakar (n) T KA კორპორაციის ფარგლებში დასაქმებული პირი U UK Міжкорпоративно переведений працівник HY ներկորպորատիվ ցանցում փոխադրվող աշխատակից V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 341
intra-EU mobility BG движение в рамките на ЕС CS mobilita v rámci EU Definition(s) EL κινητικότητα στο εσωτερικό της ΕΕ/ ενδοκοινοτική κινητικότητα Action of persons (EU nationals or legally resident thirdcountry nationals) undertaking their right to free movement by moving from one EU Member State to another. EN intra-EU mobility Source(s) DE EU-Binnenmobilität; EU-Freizügigkeit ES movilidad intracomunitaria ET Euroopa Liidu sisene liikuvus FI EU:n sisäinen liikkuvuus Derived by EMN from the definition of ‘right to free movement’ in the EMN Glossary Synonym(s) IT mobilità intra-UE EU mobility free movement intra EU / EFTA-mobility Inter-EU migration Intra-EU migration third-country national mobility LT judumas ES viduje Broader term(s) FR mobilité intra-UE GA gluaisteacht san AE HR mobilnost unutar EU-a HU EU-n belüli mobilitás LV ES iekšējā mobilitāte right to free movement MT Intramobbiltà fl-UE EMN Asylum and Migration Classification NL mobiliteit binnen de EU 3. Legal Migration PL mobilność wewnątrzunijna Euro Voc Classification PT mobilidade intra-UE RO mobilitate intra UE SK mobilita v rámci Európskej únie / mobilita v rámci EÚ SL mobilnost znotraj EU SV EU-intern rörlighet NO mobilitet mellom EUs medlemsland KA მობილობა ევროკავშირის ფარგლებში UK мобільність у межах ЄС HY 342 1011 European Union law| 2811 migration Note(s) 1. Free movement / intra-EU mobility is available under two different schemes. The first scheme is a very open one and applicable to EU citizens who benefit from full freedom of movement. The second scheme concerns migrant workers. Rules applicable here are less generous and limited to specific categories of third-country nationals, i.e. long-term residents, highly skilled workers, researchers and students. 2. Through separate agreements between the EU and IS, LI, NO and CH, the same rights to free movement apply to their citizens and their territories. ԵՄ ներքին շարժունակություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 343
irregular entry BG незаконно влизане CS neoprávněný vstup na území Definition(s) ET ebaseaduslik (riiki) sisenemine In the global context, crossing borders without complying with the necessary requirements for legal entry into the receiving State. In the Schengen context, the entry of a third-country national into a Schengen Member State who does not satisfy Art. 5 of the Regulation (EU) 2016/399 (Schengen Borders Code) . FI säännösten vastainen maahantulo Source(s) DE irreguläre Einreise EL παράτυπη είσοδος EN irregular entry ES entrada irregular HU irreguláris belépés Global context: Definition for ‘illegal entry’ in Art. 3(b) of the Protocol against the Smuggling of Migrants by Land, Sea and Air, Supplementing the UN Convention against Transnational Organized Crime Schengen context: Developed by EMN IT ingresso irregolare Synonym(s) FR entrée irrégulière GA iontráil aimhrialta HR nezakoniti ulazak LV nelikumīga ieceļošana illegal entry unauthorised crossing of the external EU border MT Dħul irregolari Broader term(s) LT neteisėtas atvykimas NL illegale binnenkomst / onregelmatige of irreguliere binnenkomst irregular migration PL nieregularny wjazd SK nelegálny vstup / neoprávnený vstup border control external EU border internal EU border legal entry Schengen Borders Code SL nedovoljeni vstop / nezakoniti vstop EMN Asylum and Migration Classification PT entrada irregular RO intrare neregulamentară / intrare ilegală / trecere neautorizată a frontierei Related term(s) SV olaglig inresa 13. Irregular Migration NO irregulær innreise Euro Voc Classification KA კანონიერი საფუძვლის გარეშე შესვლა 2811 migration UK нелегальний в’їзд HY 344 անկանոն մուտք EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. The European Commission favours nowadays the term ‘irregular entry’ instead of ‘illegal entry’. 2. Art. 5 of the Regulation (EU) 2016/399 (Schengen Borders Code) states that for stays not exceeding three months per six-month period, the entry conditions for third-country nationals shall be the following: a) they are in possession of a valid travel document or documents authorising them to cross the border; b) they are in possession of a valid visa, if required pursuant to Council Regulation (EC) No 539/2001 (Visa Regulation) listing the third countries whose nationals must be in possession of visas when crossing the external borders and those whose nationals are exempt from that requirement (17), except where they hold a valid residence permit; c) they justify the purpose and conditions of the intended stay, and they have sufficient means of subsistence, both for the duration of the intended stay and for the return to their country of origin or transit to a third country into which they are certain to be admitted, or are in a position to acquire such means lawfully; d) they are not persons for whom an alert has been issued in the SIS for the purposes of refusing entry; e) they are not considered to be a threat to public policy, internal security, public health or the international relations of any of the EU Member States, in particular where no alert has been issued in EU Member States’ national data bases for the purpo 3. Art. 2(1) of the Proposal for a Regulation introducing a screening of third country nationals at the external borders, COM(2020) 612 final uses the term ‘unauthorized crossing of the external EU border’ with the follwoing definition: Crossing of the external EU border by land, sea or air, at places other than border crossing points or at times other than the fixed opening hours, as referred to in Art. 5(3) of Regulation (EU) 2016/399 (Schengen Borders Code). 4. For more information, see Regulation (EU) 2016/399 (Schengen Borders Code) F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 345
irregular migrant BG незаконен мигрант CS neregulérní migrant DE irregulärer Migrant EL παράτυπος μετανάστης EN irregular migrant ES inmigrante en situación irregular ET ebaseaduslikult riigis viibiv isik FI säännösten vastaisesti maassa oleskeleva henkilö FR migrant en séjour irrégulier GA imirceach neamhrialta Definition(s) In the global context, a person who, owing to irregular entry, breach of a condition of entry or the expiry of their legal basis for entering and residing, lacks legal status in a transit or host country. In the EU context, a third-country national present on the territory of a Schengen State who does not fulfil, or no longer fulfils, the conditions of entry as set out in the Regulation (EU) 2016/399 (Schengen Borders Code) , or other conditions for entry. Source(s) IT migrante irregolare Global context: Developed by EMN EU context: Derived by EMN from the definition of ‘illegal stay’ in Art. 3 of Directive 2008/115/EC (Return Directive) LT neteisėtas migrantas Synonym(s) HR nezakoniti migrant HU irreguláris migráns LV neatbilstīgs migrants (EU acquis); nelikumīgs migrants (national) MT migrant irregolari NL illegaal verblijvende migrant / onregelmatig of irregulier verblijvende migrant PL migrant nieregularny PT imigrante irregular clandestine migrant illegal migrant insufficiently documented migrant migrant in an irregular siuation migrant with irregular status unauthorised migrant undocumented migrant RO migrant în situație neregulamentară / migrant aflat în situație ilegală Broader term(s) SK neregulárny migrant / nelegálny migrant / migrant bez platného povolenia na pobyt / migrant bez oprávnenia na pobyt Narrower term(s) SL nezakoniti migrant / migrant z neurejenim statusom SV irreguljär migrant NO irregulær migrant KA კანონიერი საფუძვლის გარეშე მყოფი მიგრანტი UK нерегулярний мігрант HY 346 անկանոն կարգավիճակով միգրանտ migrant third-country national found to be illegally present Related term(s) apprehension irregular migration overstayer) EMN Asylum and Migration Classification 13. Irregular Migration Euro Voc Classification 2811 migration EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. The International Organization for Migration (IOM) defines the term ‘ migrant in an irregular situation’ as follows: A person who moves or has moved across an international border and is not authorized to enter or to stay in a State pursuant to the law of that State and to international agreements to which that State is a party. 2. The term ‘irregular’ is preferable to ‘illegal’ migrant because the latter carries a criminal connotation, entering a country in an irregular manner, or staying with an irregular status, is not a criminal offence but an infraction of administrative regulations. Apart from this, juridically and ethically, an act can be legal or illegal but a person cannot. Thus more and more the term ‘migrant in an irregular situation’ or ‘migrant with irregular status’ is preferred. 3. The European Commission has used the term ‘third-country national found to be illegally present’ or ‘illegally resident/staying third-country national’ in legislation.’Third-country national found to be illegally present’ is defined in Art. 2(r) of Regulation (EC) No 862/2007 (Migration Statistics Regulation) and ‘illegally staying third-country national’ in Art. 2(b) of Directive 2009/52/EC (Employer Sanctions Directive) or in Regulation (EU) 2018/1860 on the use of the Schengen Information System for the return of illegally staying third-country nationals. 4. The Council of Europe differentiates between illegal migration and irregular migrant. Referring to Resolution 1509 (2006) of the Council of Europe Parliamentary Assembly , ‘illegal’ is preferred when referring to a status or process, whereas ‘irregular’ is preferred when referring to a person. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 347
irregular migration BG незаконна миграция CS neregulérní migrace DE irreguläre Migration EL παράτυπη μετανάστευση EN irregular migration ES inmigración irregular ET ebaseaduslik ränne FI säännösten vastainen maahanmuutto FR migration irrégulière GA Imirce neamhrialta HR nezakonite migracije HU irreguláris migráció IT migrazione irregolare LT neteisėta / nereguliari migracija LV neatbilstīga migrācija (EU acquis); nelikumīga migrācija MT Migrazzjoni irregolari NL illegale migratie / irreguliere migratie PL migracja nieregularna PT migração irregula RO migrație neregulamentară / migraţie ilegală SK neregulárna migrácia / nelegálna migrácia SL nedovoljene migracije Definition(s) Movement of persons to a new place of residence or transit that takes place outside the regulatory norms of the sending, transit and receiving countries. Source(s) Derived by EMN from IOM Glossary on Migration, 2019. Synonym(s) illegal migration undocumented migration illegal immigration unauthorised migration clandestine migration Broader term(s) migration Narrower term(s) irregular entry irregular stay secondary movement of migrants Related term(s) irregular migrant EMN Asylum and Migration Classification 13. Irregular Migration Euro Voc Classification 2811 migration SV irreguljär migration NO irregulær migrasjon KA კანონიერი საფუძვლის გარეშე მიგრაცია UK нерегулярна міграція HY 348 անկանոն միգրացիա Note(s) 1.There is no universally accepted definition of irregular migration. From the perspective of destination countries it is entry, stay or work in a country without the necessary authorisation or documents required under immigration regulations. From the perspective of the sending country, the irregularity is, for example, seen in cases in which a person crosses an international boundary without a valid passport or travel document or does not fulfil the administrative requirements for leaving the country. There is, however, a tendency to restrict the use of the term to cases of smuggling of migrants and trafficking in human beings. 2. Defining irregular migration has been the subject of considerable debate. Terms such as illegal, undocumented, non-documented, and unauthorised migration can have different connotations in national policy debates. Due to this and the assocation with criminality the term ‘illegal migration” should be avoided, as most irregular migrants are not criminals. Being in a country without the required papers is, in most countries, not a criminal offence but an administrative infringement. 3. While the UN use the term ‘irregular’ or ‘undocumented’ migration, the European Commission favoured for a long time the term ‘illegal immigration’, but more recently refers to ‘irregular migration’ as well. 4. The Council of Europe differentiates between illegal migration and irregular migrant. Referring to Resolution 1509 (2006) of the Council of Europe Parliamentary Assembly, ‘illegal’ is preferred when referring to a status or process, whereas ‘irregular’ is preferred when referring to a person. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
Irregular Migration Management Application (IRMA) BG приложение за управление на незаконната миграция A B C D Definition(s) A restricted and secure information exchange platform developed by the European Commission which connects EU Member and Schengen States, the European Commission, the European Border and Coast Guard Agency (Frontex) and the relevant EU funded programmes at operational, practitioner level and which facilitates the planning, organisation and implementation of return and readmission activities with the objective of making return procedures more effective. CS Systém pro správu dat o nelegální migraci DE Anwendung für die Steuerung der irregulären Migration EL Εφαρμογή για τη Διαχείριση της Παράτυπης Μετανάστευσης (IRMA) EN Irregular Migration Management Application (IRMA) ES Aplicación para la gestión de la migración irregular ET Ebaseadusliku rände haldamise rakendus Source(s) FI Palauttamistoimien hallinnointia koskeva tietojenvaihtosovellus (IRMA) HU Irreguláris migráció-kezelési alkalmazás Derived by EMN from European Commission: Communication on a more effective return policy in the European Union - A renewed action plan, COM (2017) 200 final and European Commission: Progress report on the European Agenda on Migration COM (2017) 669 final and Technical guidelines for return operational data collection IT Applicazione di gestione integrata dei rimpatri Synonym(s) FR Application de gestion de la migration irrégulière GA Feidhmchlár Bainistíochta Comhtháite maidir le Filleadh HR Aplikacija za upravljanje nezakonitim migracijama (IRMA) LT Neteisėtos migracijos valdymo programa IRMA LV Neatbilstīgas migrācijas pārvaldības lietotne MT Applikazzjoni ta’ Ġestjoni Integrata għall-Migrazzjoni Irregolari NL EU-toepassing voor geïntegreerd terugkeerbeheer PL Aplikacja Zarządzania Migracjami Nieuregulowanymi PT Aplicação de Gestão de Migração Irregular RO Aplicație de gestionare a migrației ilegale SL Aplikacija za upravljanje nedovoljenih migracij (IRMA) UK Застосунок для управління нерегулярною міграцією (IRMA) HY Անկանոն միգրացիայի կառավարման հավելված H I J K L M O Related term(s) P EMN Asylum and Migration Classification Q Euro Voc Classification R return operation S SV Applikation för hantering av irreguljär migration Note(s) KA არალეგალური მიგრაციის მართვის პროგრამა G readmission return 2811 migration NO Irregular Migration Management Application (no usual translation) F N Broader term(s) 13. Irregular Migration SK Aplikácia pre integrované riadenie návratov (IRMA) E 1. Irma was implemented on 1 September 2017 under the name ‘Return Management Application’ which was later changed to ‘Irregular Migration Management Application’, the acronym ‘IRMA’ remains the same. 2. IRMA contains information on best practices and guidelines per third country, legislation, return programmes, operational data on return operations and statistics. 3. IRMA aims at building synergies and enabling work in a mutually reinforcing way. It also allows Frontex to assume a more pro-active role in planning joint return operations. T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 349
irregular stay BG незаконно пребиваване CS neoprávněný pobyt DE irregulärer Aufenthalt EL παράτυπη διαμονή EN irregular stay ES estancia irregular Definition(s) The presence on the territory of an EU Member State of a third-country national who does not fulfil, or no longer fulfils the conditions of entry as set out in Art. 5 of the Regulation (EU) 2016/399 (Schengen Borders Code) or other conditions for entry, stay or residence in that EU Member State. ET ebaseaduslik riigis viibimine / seadusliku aluseta riigis viibimine Source(s) FI säännösten vastainen maassa oleskelu Synonym(s) FR séjour irrégulier GA cuairt aimhrialta HR nezakoniti boravak HU szabálytalan tartózkodás IT soggiorno irregolare Art. 3 (2) of Directive 2008/115/EC (Return Directive) illegal stay Broader term(s) irregular migration Related term(s) LV nelikumīga uzturēšanās irregular entry overstayer) third-country national found to be illegally present MT Qagħda / Waqfa / Żjara irregolari EMN Asylum and Migration Classification LT neteisėtas buvimas NL illegaal verblijf / onregelmatig of irregulier verblijf 13. Irregular Migration PL nieregularny pobyt Euro Voc Classification PT permanência irregular 2811 migration RO ședere neregulamentară / ședere ilegală / ședere neautoriz Note(s) SK neoprávnený pobyt / neregulárny pobyt / nelegálny pobyt The European Commission favours nowadays the term ‘irregular stay’ instead of ‘illegal stay’ which was the term used in the Directive 2008/115/EU (Return Directive) . SL nedovoljeno prebivanje / nezakonito prebivanje SV olaglig vistelse NO irregulært opphold (b); irregulært opphald (n) KA კანონიერი საფუძვლის გარეშე ყოფნა UK нелегальне перебування HY 350 անկանոն կեցություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B ius sanguinis BG no translation CS ius sanguinis / právo krve C D Definition(s) ES ius sanguinis The determination of a person’s nationality on the basis of the nationality of their parents (or one parent or one particular parent) at the time of the target person’s birth and at the time of acquisition of nationality by the target person (the two points in time are different in cases of acquisition after birth). ET vereõigus Source(s) DE Abstammungsprinzip / Ius sanguinis EL δίκαιο του αίματος / ius sanguinis EN ius sanguinis FI periytymisperiaate FR droit du sang GA ius sanguinis HR ius sanguinis/načelo krvne veze HU ius sanguinis (vér szerinti leszármazás elve) IT ius sanguinis LT kraujo teisė LV Ius sanguinis MT Ius sanguinis NL ius sanguinis / jus sanguinis / afstammingsbeginsel PL prawo krwi PT ius sanguinis RO ius sanguinis / legea sângelui SK právo krvi / ius sanguinis Global Citizenship Observatory (GLOBALCIT): Glossary on Citizenship and Electoral Rights Synonym(s) jus sanguinis ius sanguinis F G H I J Related term(s) K acquisition of citizenship ius soli L Euro Voc Classification 1231 international law M Note(s) This definition uses the term in a broad way that covers not only automatic acquisition at birth, but also non-automatic acquisition at birth and after birth. Ius sanguinis generally applies to legal parenthood (in cases where legal parenthood differs from biological parenthood). SL ius sanguinis N O P SV jus sanguinis / härstamningsprincipen NO jus sanguinis / nedstammingsprinsippet Q KA იუს სანგვინის (ius sanguinis/„სისხლის პრინციპი“) R UK ius sanguinis (право крові) HY E S արյան իրավունք (ius sanguinis) T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 351
ius soli BG no translation CS ius soli / právo půdy Definition(s) DE Territorialprinzip / Ius soli / Geburtsortprinzip The principle that the nationality of a person is determined on the basis of their country of birth. EL δίκαιο του εδάφους / ius soli Source(s) EN ius soli ES ius soli ET sünnikohaõigus FI syntymäperiaate FR droit du sol GA ius soli HR ius soli HU ius soli (területi elv) IT ius soli LT žemės teisė LV Ius soli MT Ius soli Global Citizenship Observatory (GLOBALCIT): Glossary on Citizenship and Electoral Rights Synonym(s) jus soli Related term(s) acquisition of citizenship ius sanguinis Euro Voc Classification 1231 international law Note(s) This definition uses the term in a broad way that covers not only automatic acquisition at birth but also non-automatic acquisition at birth and after birth. NL ius soli / jus soli / territorialiteitsbeginsel PL prawo ziemi PT ius soli RO ius soli / legea locului SK právo zeme / ius soli SL ius soli / načelo teritorialnosti SV jus soli / territorialprincipen NO jus soli / territorialprinsippet KA იუს სოლი (ius soli/„მიწის პრინციპი“) UK ius soli / право ґрунту HY 352 հողի իրավունք (ius soli) EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B Joint Valletta Action Plan (JVAP) BG Съвместен план за действие от Валета CS Společný valletský akční plán DE Gemeinsamer Aktionsplan von Valetta EL Κοινό Σχέδιο Δράσης της Βαλέτα EN Joint Valletta Action Plan (JVAP) ES Plan de Acción Conjunto de La Valeta ET Valletta ühine tegevuskava C D Definition(s) A set of political and operational measures to enhance cooperation between African and European countries with the aim to provide a framework for humane and sustainable management of migration on both sides of the Mediterranean. Source(s) FI Vallettan yhteinen toimintasuunnitelma Joint Valetta Action Plan on the Website of ICMPD and Valetta Summit, 11-12 November 2015, Action Plan. FR Plan d’Action Conjoint de la Valette (PACV) Synonym(s) GA Plean comhpháirteach gníomhaíochta Vaileite HU Közös Vallettai Cselekvési terv JVAP Valetta Joint Action Plan Valetta Summit Action Plan IT Piano di azione congiunto della Valletta Related term(s) HR Zajednički akcijski plan iz Vallette LT Bendras Valetos veiksmų planas LV Apvienotais Valletas rīcības plāns MT Pjan (Il-) t’ Azzjoni Konġunta ta’ Valletta (PAKV) NL Gezamenlijk actieplan van Valletta PL Wspólny Plan Działania z Valetty PT Plano de ação conjunta de Valeta (PACV) RO Planul de acțiune de la Valletta SK spoločný akčný plán z Valletty (JVAP) SL Skupni akcijski načrt iz Vallette SV handlingsplanen från Valletta / den gemensamma handlingsplanen från Valletta NO Felles handlingsplan for Valletta-samarbeidet KA ვალეტის ერთობლივი სამოქმედო გეგმა UK Спільний Валлетський план дій HY Վալետայի միացյալ գործողությունների ծրագիր E F G H I J Rabat Process Khartoum Process European Union Emergency Trust Fund for Africa (EUTF for Africa) EMN Asylum and Migration Classification 15.1 EU External dimension of migration and mobility K L M N Euro Voc Classification 2811 migration O Note(s) P 1. The Joint Valletta Action Plan which is also known as Valetta Summit Action Plan was adopted at the Valletta Summit on 11-12 November 2015 which marked the beginning of an intensified partnership between Africa and the European Union in regard to migration management. The Action Plan is drawing on the recommendations of the Rabat Process and the Khartoum Process and provides a set of political and operational measures. 2. The five priority domains of the JVAP are: ƒ development benefits of migration and addressing root causes of irregular migration and forced displacement; ƒ legal migration and mobility; ƒ protection and asylum; ƒ prevention of and fight against irregular migration, smuggling of migrants and trafficking in human beings; ƒ return, readmission and reintegration. 3. In order to support the most fragile and affected African countries in implementing the JVAP, a financial instrument was launched at the Summit: the European Union Emergency Trust Fund for Africa (EUTF). Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 353
Khartoum Process BG процес от Хартум CS Chartúmský proces DE Khartum-Prozess EL Διαδικασία του Χαρτούμ EN Khartoum Process ES Proceso de Jartum ET Hartumi protsess FI Khartumin prosessi FR Processus de Khartoum GA Próiseas Chartúm HR Khartoumski proces HU Kartúm Folyamat IT Processo di Khartoum LT Chartumo procesas LV Hartūmas process MT Proċess (Il-) ta’ Kartum NL Khartoem-proces / Proces van Khartoem PL Proces chartumski PT Processo de Cartum RO Procesul de la Khartoum SK Chartúmsky proces SL Kartumski proces SV Khartoumprocessen NO Khartoumprosessen KA ხარტუმის პროცესი UK Хартумський процес HY 354 Քարտումի գործընթաց Definition(s) A platform for political cooperation amongst the countries along the migration route between the Horn of Africa and Europe with a focus on combating trafficking in human beings and smuggling of migrants. Source(s) Website of the Khartoum Process Synonym(s) EU-Horn of Africa-Migration Route Initiative Related term(s) European Union Emergency Trust Fund for Africa (EUTF for Africa) Rabat Process regional development and protection programme (RDPP) EMN Asylum and Migration Classification 15.1 EU External dimension of migration and mobility Euro Voc Classification 04 Politics| 2811 migration Note(s) 1. The Platform is also known as the EU-Horn of Africa Migration Route Initiative. The initiative was officially launched at the Rome Ministerial Conference on 28 November 2014 with the adoption of the Rome Declaration. Starting in 2012, the engagement of Egypt, Eritrea, Ethiopia and Sudan as core countries, affected by human trafficking incidents laid the groundwork for the establishment of the Khartoum Process in 2014. 2. The inter-continental consultation framework aims at: ƒ establishing a continuous dialogue for enhanced cooperation on migration and mobility; ƒ identifying and implementing concrete projects to address human trafficking and the smuggling of migrants; ƒ giving a new impetus to the regional collaboration between countries of origin, transit and destination regarding the migration route between the Horn of Africa and Europe. 3. Projects contributing to the development of national and regional strategies on migration management under the Khartoum as well as the Rabat Process are partly funded by the European Union Emergency Trust Fund for Africa (EUTF for Africa). EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 355
labour market integration BG интегриране на пазара на труда CS integrace na pracovní trh DE Arbeitsmarktintegration / Eingliederung in den Arbeitsmarkt EL ένταξη στην αγορά εργασίας / εργασιακή ένταξη EN labour market integration Definition(s) The extent to which migrants will achieve the same range of labour market participation as nationals of receiving countries by using their skills and realising their economic potential. Source(s) GA imeascadh i margadh an tsaothair Derived by EMN from DG Migration and Home Affairs Website: Legal migration and integration and Towards a framework for fair and effective integration of migrants into the labour market, OECD, WorldBank, ILO, IMF, 19. -21. December 2016 and OECD and EU: Settling in 2018: Indicators of Immigrant Integration, 9 December 2018 HR integracija na tržište rada Synonym(s) ES Integración en el mercado de trabajo ET tööturule lõimimine/integreerimine FI työmarkkinoille integroituminen / työmarkkinoille sijoittuminen FR intégration sur le marché du travail HU munkaerő-piaci integráció IT integrazione lavorativa LT integracija į darbo rinką LV integrācija darba tirgū MT integrazzjoni fis-suq tax-xogħol NL Arbeidsmarktintegratie PL integracja na rynku pracy PT integração no mercado de trabalho RO integrare pe piața muncii / integrare pe piața forței de muncă immigrant labour market integration integration of migrants into the labour market Broader term(s) integration EMN Asylum and Migration Classification 3.1 Migration for Economic Purposes| 8.2 Access to employment Euro Voc Classification 2811 migration| 4411 labour market SK integrácia na trh(u) práce SL vključevanje na trg dela SV arbetsmarknadsintegration NO arbeidsmarkedsintegrering KA ინტეგრაცია შრომის ბაზარზე UK інтеграція до ринку праці HY 356 ինտեգրում աշխատաշուկային EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. Even though there are many studies dealing with challenges and obstacles to successful labour market integration, there is no universally accepted definition of labour market integration at international or European level. 2. The labour market integration of migrants is measured by monitoring gaps and differences in labour market participation between nationals and non-nationals in terms of employment rate, unemployment rate, labour force activity rate, wage convergence, levels of self-employment, working conditions and types of contracts. Explaining labour market integration outcomes and processes require a multidimensional analysis, taking into account both individual and structural characteristics. At the individual level, explanatory factors include the person’s qualifications, educational attainment, language proficiency, skills level; at the structural level, explanatory factors include the segmentation of occupational structures, mismatches between supply and demand, policies and institutional ar-rangements (e.g. for the recognition of skills and of foreign educational titles), levels of ethnic stratification, the presence of discrimination and of ethnic penalties. 3. The labour force activity rate is calculated as the proportion of working age adults in the population who are in the labour force, which consists of the number of people employed and unemployed. For more information see: ESRI: Monitoring Report on Integration, Chapter 2, Employment and Integration, 2018. 4. Although integration policy falls within the national competence of EU Member States, European institutions have - arising from the Treaty of Lisbon - a mandate to support EU Member States to promote the integration of third-country nationals. The European Commission noted in their Action Plan on the integration of third-country nationals in 2016, that employment is key to ensure their effective integration into the host societies and their positive impact on the EU economy. The EU acquis is already regulating areas closely related to the promotion of labour market integration of third-country nationals. EU legislation includes provisions on equal access to the labour market, such as Art. 11(1)a of Council Directive 2003/109/EC (Long-term Residents Directive) or Art. 12 of Directive 2011/98/EU (Single Permit Directive) which provides for equal treatment with regard to working conditions, including pay and dismissal as well as health and safety at the workplace. 5. The EMN Study ‘Labour Market Integration of Third-Country Nationals in EU Member States 2019’ gives a comprehensive overview of different labour market integration policies in place in EU Member States with a focus on first generation third-country nationals, outlines the most common obstacles to labour market integration and presents best practices. For further information see the synthesis report of this study available on the EMN website. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 357
labour market test BG тест на пазара на труда CS test trhu práce Definition(s) ES Catálogo de ocupaciones de difícil cobertura Mechanism that aims to ensure that migrant workers are only admitted after employers have unsuccessfully searched for national workers, EU citizens (in EU Member States this also means EEA workers) or legally residing third-country nationals with access to the labour market according to national legislation. ET tööturu test Source(s) DE Arbeitsmarkttest EL έλεγχος της αγοράς εργασίας EN labour market test FI työvoiman saatavuusharkinta FR examen du marché du travail / examen du marché de l’emploi; opposabilité de la situation de l’emploi (FR); test du marché (de l’emploi) (LU) GA tástáil sa mhargadh fostaíochta HR test tržišta rada Derived by EMN from Oxford Migration Observatory response to Call for Evidence Synonym(s) LMT Broader term(s) HU munkaerő-piaci felmérés labour migration union preference IT analisi del mercato del lavoro EMN Asylum and Migration Classification LT darbo rinkos testas LV darba tirgus tests MT Test dwar is-suq tax-xogħol NL arbeidsmarkttoets PL test rynku pracy PT contingente global de oportunidades de emprego RO testarea pieţei forţei de muncă SK skúmanie situácie na trhu práce SL preizkus trga dela SV arbetsmarknadsprövning NO arbeidsmarkedsvurdering (b); arbeidsmarknadsvurdering (n) 3.1 Migration for Economic Purposes| 8.2 Access to employment Euro Voc Classification 2811 migration| 4411 labour market Note(s) 1. The labour market test (LMT) is implemented and applied widely in most EU Member States. Where the LMT is applied, some categories of workers can be exempt, reflecting the specific national situations and priorities. 2. EU Member States apply different methodologies in undertaking LMTs. In general, a considerable role is left to employers and public employment services. Duration of the verification process varies among EU Member States. 3. For further information, see EMN: Satisfying labour demand through migration, June 2011 . KA შრომის ბაზრის ტესტი UK аналіз ринку праці HY 358 աշխատաշուկայի քննություն (թեստ) EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B labour matching C BG срещане на търсенето и предлагането на работна сила CS párování nabídky s poptávkou na pracovním trhu DE Ausrichtung des Profils der Arbeitskräfte auf die Arbeitsmarkterfordernisse EL αντιστοίχιση του εργατικού δυναµικού με την αναγνώριση δεξιοτήτων EN labour matching ES Adecuación de la oferta y la demanda en el Mercado Laboral D Definition(s) The process by which the skills and qualifications of a worker is compared with the requirements of a particular job vacancy, to establish whether they match wholly or partly. E Source(s) G Derived by EMN on the basis of information on the Website of the World Association of Public Employment Services F H Synonym(s) I ET tööturuvajadused skill matching FI työvoiman kysynnän ja tarjonnan kohtaanto EMN Asylum and Migration Classification J Euro Voc Classification K 8.2 Access to employment FR rapprochement de l’offre et de la demande de main-d’œuvre; adéquation entre le profil du travailleur et les caractéristiques du poste (FR) 2811 migration| 4411 labour market GA comhoiriúnú saothair HR povezivanje vještina i kvalifikacija radnika s potrebama na tržištu rada L Note(s) There is no recognised international definition of the term, although it is frequently used by employment agencies (public and private) as well as by economic and labour market research and policy discussions. HU munkaerő-piac keresleti és kínálati oldalának összehangolása M N IT incontro fra domanda e offerta di lavoro LT atitiktis darbo rinkos poreikiams O LV darbaspēka atbilstības izvērtēšana MT Tlaqqigħ tal-impiegi mal-profil tal-ħaddiema P NL afstemming van arbeidsvraag en -aanbod PL dopasowanie kwalifikacji i umiejętności pracownika do wymogów konkretnej oferty pracy Q PT adequação entre oferta e procura de trabalho / adequação entre o perfil do trabalhador e as caraterísticas do posto de trabalho R S RO concordanță a forței de muncă SK umiestňovanie pracovných síl T SL usklajevanje ponudbe in povpraševanja na trgu dela SV arbetskraftsmatchning U NO kobling av arbeidssøker til arbeidstilbud (b); kopling av arbeidssøkjar til arbeidstilbod (n) V KA სამუშაო ძალის შესაბამისობა UK відповідність кваліфікації працівника вимогам роботи W HY X աշխատուժի համապատասխանություն հմտությունների ճանաչմամբ Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 359
labour migration BG трудова миграция CS pracovní migrace DE Arbeitsmigration EL οικονομική μετανάστευση / μετανάστευση για εργασία EN labour migration ES migración laboral ET tööränne FI työperusteinen maahanmuutto FR migration de travail / migration de la main d’œuvre / migration professionnelle GA imirce lucht oibre HR radne migracije HU munkavállalási célú migráció IT migrazione per motivi di lavoro LT darbo migracija LV darbaspēka migrācija MT Migrazzjoni għal raġunijiet ta’ xogħol NL arbeidsmigratie PL migracja pracownicza PT migração laboral RO migrație a forței de muncă / migraţie în scop de muncă Definition(s) Movement of persons from one state to another, or within their own country of residence, for the purpose of employment. Source(s) IOM Glossary on Migration, 2019. Broader term(s) economic migration Narrower term(s) immigration quota labour market test Related term(s) migrant worker EMN Asylum and Migration Classification 3.1 Migration for Economic Purposes Euro Voc Classification 2811 migration| 4406 employment Note(s) Labour migration is addressed by most States in their migration laws. In addition, some States take an active role in regulating outward labour migration and seeking opportunities for their nationals abroad. SK pracovná migrácia SL delovne migracije SV arbetskraftsmigration NO arbeidsmigrasjon KA შრომითი მიგრაცია UK трудова міграція HY 360 աշխատանքային միգրացիա EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B labour shortage BG недостиг на работна сила CS nedostatek pracovních sil C D Definition(s) ES escacez de la mano de obra Shortage of labour of a particular type in a particular labour market which may be said to exist when the number of vacancies has been (or is expected to be) above a level considered to represent ‘normal’ turnover at the prevailing wages and working conditions for an extended period. ET tööjõupuudus Source(s) DE Arbeitskräftemangel EL έλλειψη εργατικού δυναμικού EN labour shortage FI työvoimapula FR pénurie de main d’œuvre GA ganntanas lucht saothair HR nedostatak radne snage HU munkaerőhiány IT carenza di forza lavoro LT darbo jėgos trūkumas LV darbaspēka trūkums MT nuqqas ta’ ħaddiema NL tekort aan arbeidskrachten PL niedobór siły roboczej PT falta de mão-de-obra RO deficit de forță de muncă SK nedostatok pracovnej sily / nedostatková profesia F G Derived by EMN from sources quoted in ‘Collecting statistics on imbalances in the demand for labour’, Statistical Journal of the United Nations ECE,16 (1999). p. 105 - 121. H Narrower term(s) J EMN Asylum and Migration Classification K skills shortage 14.2 Economic factors and impacts (such as brain drain/ gain, employment/ unemployment, labour market, economic growth, dumping) Euro Voc Classification I L M 44 Employment and Working Conditions N Note(s) There is no recognised international definition of the term, although it is frequently used by employment agencies (public and private) as well as by economic and labour market research and policy discussions. SL pomanjkanje delavcev / pomanjkanje delovne sile O P SV arbetskraftsbrist NO mangel på arbeidskraft Q KA სამუშაო ძალის ნაკლებობა R UK нестача робочої сили HY E աշխատուժի պակաս S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 361
language analysis for the determination of origin (LADO) BG езиков анализ за определяне на произхода CS analýza jazyka pro určení původu DE Sprachanalyse zur Bestimmung der Herkunft EL Ανάλυση γλώσσας για τον καθορισμό πιθανής χώρας και / ή περιοχής καταγωγής Definition(s) Analysis of mainly spoken, but also written, language as a method for helping to establish the nationality, region or ethnic origin of third-country nationals/migrants. Source(s) EN language analysis for the determination of origin Developed by EMN ES análisis lingüístico para la determinación del origen Synonym(s) ET keeleanalüüs isiku päritolu väljaselgitamiseks FI kielianalyysi henkilön alkuperän selvittämiseksi FR analyse linguistique pour la détermination de l’origine GA anailís teanga le bunús eitneach a chinneadh HR analiza jezika radi utvrđivanja zemlje podrijetla (LADO) HU nyelvi elemzés a származás megállapítására LADO language and speech analysis for the determination of origin speech-text-analysis Broader term(s) establishment of identity EMN Asylum and Migration Classification LT kalbos analizė kilmei nustatyti 6.3.2. Establishment of identity of applicants for international protection (incl. examination of documents, language analysis, age assessment) LV valodas analīze, lai noteiktu izcelsmi Euro Voc Classification IT analisi linguistica per la determinazione dell’origine MT determinazzjoni tal-oriġini tal-analiżi lingwistika / preċiżazzjoni tal-oriġini tal-analiżi lingwistika NL taalanalyse voor de bepaling van de herkomst PL analiza językowa określająca pochodzenie PT análise da linguagem para determinação da origem RO analiză lingvistică pentru determinarea originii SK analýza jazyka na určenie pôvodu (LADO) SL jezikovna analiza za ugotavljanje izvora / porekla SV språkanalys för att fastställa ursprung NO språkanalyse for å vurdere opprinnelsesland / -område (b); språkanalyse for å vurdere opphavsland / -område (n) KA ენის ანალიზი წარმომავლობის დადგენის მიზნით (LADO) UK мовний аналіз для визначення походження (LADO) HY 362 Լեզվի վերլուծություն՝ ծագման հնարավոր երկրի և/ կամ տարածաշրջանի որոշման համար 2811 migration Note(s) 1. Language analyses are usually made at the request of government immigration/asylum agencies attempting to verify asylum claims, but may also be performed as part of the appeals process for claims which have been denied or may apply in return proceedings of other irregular migrants. For further information see e.g.: Language and Asylum Research Group 2. Speech recordings are typically analysed to determine whether an applicant’s speech patterns show expected features of the specific language variety spoken by their claimed group. The key question that can be addressed scientifically is not one of nationality but of language socialization and speech community membership, which is a sociolinguistic matter. 3. In 2004, ‘Guidelines for the use of language analysis in relation to questions of national origin in refugee cases’ were published which encompass minimum requirements and safeguards for competent professional language analysis. They serve as a reference point for governments seeking to know how to conduct their investigations in a professional manner. 4. IT does not follow a standardized, codified procedure for languages analysis. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B language training BG езиково обучение CS jazykové vzdělávání EL γλωσσική κατάρτιση / γλωσσικά μαθήματα / μαθήματα γλώσσας ES formación lingüística ET keeleõpe D Definition(s) DE Sprachkurs EN language training C In the migration context, a training course to help migrants (legally residing migrants and applicants for international protection) to learn the official language(s) of the host country to enable them to participate socially and economically in the host society. Source(s) FR formation linguistique Derived by EMN from Council of Europe and EMN AHQ on Integration measures regarding language courses and civic integration -Part 1, April 2017 GA oiliúint teanga Synonym(s) FI kielikoulutus HR tečaj učenja jezika language course HU nyelvi képzés EMN Asylum and Migration Classification IT formazione linguistica 9.1 Integration measures LT kalbos mokymai Euro Voc Classification LV valodu apmācība MT Taħriġ fl-ilsna / fil-lingwi NL Taalcursus PL kurs językowy/ szkolenie językowe PT formação linguística RO formare lingvistică SK jazykové vzdelávanie SL jezikovno usposabljanje SV språkundervisning NO språkopplæring KA ენის სწავლება UK мовна підготовка HY լեզուների ուսուցում / լեզվական դասընթացներ / լեզուների դասընթացներ E F G H I J K L 2811 migration M Note(s) 1. An increasing number of countries now require adult migrants to demonstrate proficiency in the language of the host country before granting entry, residence or work permits or citizenship. 2. Language training in EU Member States is often available. Although the conditions vary, it can be part of the (mandatory) integration programmes. In some EU Member States language training is for free or publicly funded, in others participants have to pay on their own. 3. The level of proficiency required is usually based on the Common European Framework of Reference for Languages (CEFR) and a language test may be obligatory. The approach to testing varies and there is a considerable difference in the levels of proficiency required -ranging from A1 to B1 or even B2 (oral) of the CEFR. 4. The Council of Europe has published recommendations which set out the principles governing linguistic integration in the migration field. These are complemented by language policy guidelines and reference tools developed to support their effective implementation in an inclusive approach based on shared values and principles. For further information see the website of the Council of Europe. N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 363
legal entry BG законно влизане CS oprávněný vstup DE legale Einreise EL νόμιμη είσοδος EN legal entry ES entrada legal ET seaduslik (riiki) sisenemine FI laillinen maahantulo FR entrée légale GA iontráil dhleathach HR zakoniti ulazak HU legális beutazás / legális belépés IT ingresso autorizzato LT teisėtas atvykimas LV likumīga ieceļošana MT Dħul legali NL legale binnenkomst / regelmatige binnenkomst PL legalny wjazd PT entrada legal RO intrare legală SK oprávnený vstup / legálny vstup SL zakoniti vstop SV laglig inresa NO lovlig innreise (b); lovleg innreise (n) KA ლეგალური შესვლა UK легальний в’їзд HY 364 օրինական մուտք Definition(s) In the global context, the entry of an alien into a foreign country in compliance with the necessary requirements for legal entry into the receiving State. In the Schengen context, and for a stay not exceeding three months per six-month period, the entry of a thirdcountry national into a Schengen Member State in compliance with Art. 5 of the Regulation (EU) 2016/399 (Schengen Borders Code). Source(s) Global context: Derived by EMN from the definition of ‹illegal entry› in the Art.3 of the Protocol against the Smuggling of Migrants by Land, Sea and Air, supplementing the UN Convention against Transnational Organized Crime Schengen context: Derived by EMN from Art. 5 of Regulation (EU) 2016/399 (Schengen Borders Code) Narrower term(s) admission onto the territory Related term(s) border control external EU border internal EU border irregular entry refusal of entry Schengen Borders Code EMN Asylum and Migration Classification 3. Legal Migration| 6.1 Entry Conditions and Procedures Euro Voc Classification 2811 migration EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B legal migration BG законна миграция CS legální migrace C D Definition(s) DE legale Migration Migration in accordance with the applicable legal framework. E EL νόμιμη μετανάστευση Source(s) EN legal migration Developed by EMN F ES inmigración legal Synonym(s) G ET seaduslik ränne regular migration FI laillinen maahanmuutto Broader term(s) H FR migration légale migration GA imirce dhleathach Related term(s) I HR zakonite migracije irregular migration HU legális migráció EMN Asylum and Migration Classification IT migrazione autorizzata LT teisėta migracija LV likumīga migrācija MT Migrazzjoni legali NL legale migratie / reguliere migratie PL legalna migracja J 3. Legal Migration K Euro Voc Classification 2811 migration L Note(s) M DG HOME e-Library Glossary defines the term as follows: ‘Migration that occurs through recognised, authorised channels’ (based on IOM). N PT migração legal RO migraţie legală O SK legálna migrácia SL zakonite migracije P SV laglig migration NO lovlig migrasjon) (b); lovleg migrasjon (n) Q KA ლეგალური მიგრაცია R UK легальна міграція HY օրինական միգրացիա S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 365
legal pathway BG законен път CS legální cesty DE legaler Schutzweg (EU acquis); legaler Weg EL νόμιμη οδός EN legal pathway ES vía legal ET seaduslik rändetee FI laillinen maahantuloväylä Definition(s) In the EU context, every legal mechanism and policies that enable legal migration from a third country to an EU Member State, for both international and humanitarian protection needs and labour market needs. Source(s) Derived by EMN from European Commission: Communication’ Enhancing legal pathways to Europe, COM(2018) 635 final FR voie d’entrée légale (EU acquis, BE, LU); voie d’accès légale (FR) Synonym(s) GA conair dhlíthiúil / bealach dlíthiúil Narrower term(s) HR zakonit način dolaska HU legális útvonal IT percorso legale LT teisėtas atvykimo būdas LV likumīgs ceļš / likumīga piekļuve MT Mogħdija /Proċedura legali NL legale migratiemogelijkheid PL legalna ścieżka PT vias legais RO cale le-gală de migrație SK možnosť legálnej migrácie SL zakonita pot legal avenue family reunification humanitarian admission humanitarian visa labour migration resettlement Related term(s) complementary pathway for admission to third countries legal migration EMN Asylum and Migration Classification 3. Legal Migration Euro Voc Classification 1011 European Union law| 2811 migration SV laglig migrationsväg NO lovlige veier (b): lovlege veg (n) KA ლეგალური გზა UK легальний шлях HY 366 օրինական ճանապարհ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. Controlled legal migration, whether for humanitarian reasons or based on labour market needs, is an indispensable part of a balanced and comprehensive migration policy and essential for replacing irregular and unsafe pathways.For more information see: European Commission: Communication: Enhancing legal pathways to Europe: an indispensable part of a balanced and comprehensive migration policy, COM(2018) 635 final. 2. Examples of legal pathways to the EU are labour migration, student migration, family reunification, humanitarian admission, humanitarian visa and resettlement. 3. The European Agenda on Migration of May 2015 highlighted the need of a proactive policy of sustainable, transparent, and accessible legal pathways in two ways: ƒ Providing safe and legal pathways to Europe for persons in need of international protection through resettlement and humanitarian admission which helps fighting the criminal networks of smugglers and traffickers ƒ Legal migration which makes a valuable contribution to the EU’s economic development in the medium and long term and enables the EU to respond to skills shortages. 4. The New Pact on Migration and Asylum 2020 reaffirms the importance of reducing unsafe and irregular routes and promotes sustainable and safe legal pathways for those in need of protection and the need for a legal migration policy, attracting the skills and talent that the EU needs to address labour shortages and reply to the demographic change in Europe. In addition, the annual reports on migration and asylum further develop the concept of legal pathways including concrete measures to improve the legal framework for both persons in need of protection and persons interested in labour migration. For more information see the Webpage of DG Migration and Home Affairs on Resettlement and other pathways to protection and the Webpage of DG Migration and Home Affairs on Legal Migration and Integration. 5. EU Member States are responsible for deciding how many third-country nationals they admit for employment, study and research, while EU rules define common admission conditions, procedures and rights for applicants. 6. Legal and complementary pathways for admission to third countries are different mechanisms. Legal pathway is the concept at EU level and encompasses both international protection and legal migration. Complementary pathways should not substitute the protection afforded to refugees under the international protection regime but rather complement it and serve as an important expression of global solidarity and international cooperation and a contribution to more equitable responsibility sharing. Complementary pathways should be implemented in such a way that the rights of refugees and continuing international protection needs are safeguarded. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 367
LGBTIQ BG ЛГБТ CS LGBTIQ Definition(s) DE LGBTIQ An acronym for persons who identify as lesbian, gay, bisexual, trans, intersex or queer. EL ΛΟΑΤΚΙ Source(s) EN LGBTIQ ES LGTBI (lesbianas, gais, transgénero, bisexuales e intersexuales) ET LGBTIQ FI LHBTIQ FR LGBTIQ GA LADTI (Leispiach, Aerach, Déghnéasach, Trainsinscneach, Idirghnéasach agus Aiteach) HR LGBTIQ HU LMBTIQ-Leszbikus, Meleg, Biszexuális, Transznemű, Interszexuális, Queer IT LGBTIQ LT LGBTIQ LV LGBTIQ MT LGBTIQ NL LGBTIQ+ (NL); LGBTQI+ (BE) PL LGBTI PT LGBTQIA+ (Lésbicas, Gays, Bissexuais, Trangéneros (Travestis e Transsexuais), Queer, Intersexos e demais possibilidades de orientações sexuais ou identidades de género) RO LGBTI SK lesbické, homosexuálne, bisexuálne, transrodové, intersexuálne a queer osoby / LGBTIQ osoby SL LGBTIQ (lezbijke, geji, biseksualne, trans, interseksualne in kvir osebe) SV hbtqi (homosexuella, bisexuella, trans- och queerpersoner och intersexuella) NO LHBT, lesbiske, homofile, bifile og transpersoner (b); LHBT, lesbiske, homofile, bifile og transpersonar (n) KA ლგბტიქ UK ЛГБТІ HY 368 ԼԳԲՏԻ Derived by EMN from European Commission: LGBTIQ Equality Strategy 2020-2025 Synonym(s) LGB LGBT LGBTQ LGBTIQIA Related term(s) gender-based persecution gender identity gender-specific violence particular social group sexual orientation EMN Asylum and Migration Classification 7. Vulnerable Groups Euro Voc Classification 1236 rights and freedoms Note(s) 1. There is no uniform or standardised terminology relating to diverse sexual orientations and gender identities. Terminology regarding LGBTIQ varies immensely across (sub-)cultures and countries/ regions and may change over time. 2. The EMN prefers the term LGBTIQ as this is the term used by the European Commission in its LGBTIQ Equality Strategy 2020-2025. The Strategy sets out a series of measures to integrate LGBTIQ equality in all policy areas and to help lift the voices of LGBTIQ minorities. For more information see the Webpage on the LGBTIQ Equality Strategy 2020-2025. The EUAA also uses the term LGBTIQ as e.g. in their COI LGBTIQ research guide 2021. 3. More commonly used is the acronym LGBTI, which is also the term used in the publication “Legal gender recognition in the EU”.Others also include asexual persons (LGBTQIA). The discussion over the most inclusive acronym is ongoing. 4. LGBTIQ rights in the European Union are protected under the European Union’s (EU) treaties and law. Same-sex sexual activity is legal in all EU Member States and discrimination in employment has been banned since 2000. However, EU Member States have different laws when it comes to any greater protection and discrimination against LGBTIQ people persists throughout the EU. 5. The term was added as LGBTIQ people may experience persecution, serious harm and discrimination in their countries of origin and thus it may be a reason for people to claim international protection. Art. 10 of the Recast Qualification Directive (Directive 2011/95/ EU) reiterates that sexual orientation may be invoked as one of the five existing Convention grounds for persecution. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B Lisbon Treaty BG Договорът от Лисабон CS Lisabonská smlouva C D Definition(s) ES Tratado de Lisboa An international agreement - initially known as the Reform Treaty - which amends the two treaties that form the constitutional basis of the European Union and which aims to enhance the efficiency and democratic legitimacy of the European Union and to improve the coherence of its actions. ET Lissaboni leping Source(s) DE Vertrag von Lissabon EL Η Συνθήκη της Λισαβόνας EN Lisbon Treaty FI Lissabonin sopimus Derived by EMN from Website on the Lisbon Treaty FR Traité de Lisbonne Synonym(s) HR Lisabonski ugovor Reform Treaty Treaty of Lisbon HU Lisszaboni Szerződés Related term(s) GA Conradh Liospóin IT Trattato di Lisbona LT Lisabonos sutartis LV Lisabonas līgums MT Trattat (It-) ta’ Lisbona NL Verdrag van Lissabon PL Traktat Lizboński PT Tratado de Lisboa RO Tratatul de la Lisabona SK Lisabonská zmluva SL Lizbonska pogodba SV Lissabonfördraget NO Lisboa-traktaten KA ლისაბონის ხელშეკრულება UK Лісабонська угода HY Լիսաբոնի պայմանագիր E F G H I J Common European Asylum System (CEAS) K Euro Voc Classification 1011 European Union law L Note(s) M 1. The Treaty of Lisbon was signed by the 27 EU Member States on 13 December 2007, and entered into force on 1 December 2009. It amends the Maastricht Treaty (1993), which is also known as the Treaty on European Union, and the Treaty of Rome (1952), which is also known as the Treaty establishing the European Community (TEEC). At Lisbon, the Treaty of Rome was renamed the Treaty on the Functioning of the European Union (TFEU). 2. Prominent changes included the move from unanimity to qualified majority voting in at least 45 policy areas in the Council of Ministers, a change in calculating such a majority to a new double majority, a more powerful European Parliament forming a bicameral legislature alongside the Council of ministers under the ordinary legislative procedure, a consolidated legal personality for the EU, and the creation of a long-term President of the European Council and a High Representative of the Union for Foreign Affairs and Security Policy. The Treaty also made the Union’s bill of rights, the Charter of Fundamental Rights of the European Union, legally binding. 3. The Treaty of Lisbon broadened the competences of the EU in asylum issues. According to Art. 78 TFEU, a common policy on asylum is developed through the ordinary legislative procedure. There is no mentioning of minimum standards as before which sets the aim to convergence. The Article provides for the legal basis for the Common European Asylum System (CEAS). For further information, see the entry for ‘Common European Asylum System (CEAS)’ in this EMN Glossary. 4. For more information see the Website of the Lisbon Treaty. N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 369
local border traffic BG местен граничен трафик CS malý pohraniční styk DE kleiner Grenzverkehr EL τοπική διασυνοριακή κυκλοφορία EN local border traffic ES tráfico fronterizo local ET kohalik piiriliiklus Definition(s) The regular crossing of an external land border by border residents in order to stay in a border area, for example for social, cultural or substantiated economic reasons, or for family reasons, for a period not exceeding three months. Source(s) FI paikallinen rajaliikenne Art. 3(3) of Council Regulation (EC) No 1931/2006 (Local Border Traffic Regulation) FR petit trafic frontalier Related term(s) GA trácht teorann áitiúil HR pogranični promet HU kishatárforgalom IT traffico frontaliero locale LT vietinis eismas per sieną LV vietējā pierobežas satiksme MT Traffiku lokali mal-fruntiera / mal-konfini border area border resident frontier worker EMN Asylum and Migration Classification 3. Legal Migration| 6.1.1 Border control Euro Voc Classification 2811 migration NL klein grensverkeer PL mały ruch graniczny PT pequeno tráfego fronteiriço RO mic trafic de frontieră SK malý pohraničný styk (EU acquis); prihraničná doprava SL obmejni promet SV lokal gränstrafik NO lokal grensetrafikk KA ადგილობრივი სასაზღვრო მიმოსვლა UK місцевий прикордонний рух HY 370 տեղական միջսահմանային երթևեկություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
lodging an application for international protection BG подаване на молба за международна закрила A B C D Definition(s) CS poskytnutí údajů k podané žádosti o mezinárodní ochranu E DE einen förmlichen Antrag auf internationalen Schutz stellen The act of formalising the application for international protection with the determining authority or any other body charged with lodging as per national practice. EL υποβολή/ κατάθεση αίτησης για διεθνή προστασία Source(s) G Derived by EMN from Art. 6 (2-4) of Directive 2013/32/ EU (Recast Asylum Procedures Directive) EN lodging an application for international protection ES formalizar una solicitud de protección internacional Related term(s) ET rahvusvahelise kaitse taotluse esitamine F H FI kansainvälistä suojelua koskevan hakemuksen jättäminen access to the procedure for international protection making an application for international protection I FR introduire une demande de protection internationale EMN Asylum and Migration Classification J GA iarratas ar chosaint idirnáisiúnta a thaisceadh HR podnošenje zahtjeva za međunarodnu zaštitu 6.2 Procedure for international protection/Refugee status determination Euro Voc Classification HU nemzetközi védelem iránti kérelem előterjesztése IT inoltro di una domanda di protezione internazionale LT tarptautinės apsaugos prašymo pateikimas (EU acquis); prašymo suteikti prieglobstį pateikimas LV starptautiskās aizsardzības pieteikuma iesniegšana MT Depożizzjoni ta’ applikazzjoni għall-protezzjoni internazzjonali NL indiening van een verzoek om internationale bescherming PL złożenie wniosku o udzielenie ochrony międzynarodowej / (formalne) złożenie wniosku o ochronę międzynarodową PT apresentação de pedido de proteção internacional K 2811 migration L Note(s) M 1. According to Art. 6(2) of Directive 2013/32 (Recast Asylum Procedures Directive), EU Member States have to ensure that a person who has made an application for international protection has an effective opportunity to lodge it as soon as possible and have to inform applicants where and how to lodge. 2. EU Member States may require that applications for international protection are lodged in person and/or at a designated place, Art.6(3) of Directive 2013/32 (Recast Asylum Procedures Directive). 3. An application for international protection shall be deemed to have been lodged once a form submitted by the applicant or, where provided for in national law, an official report has reached the competent authorities of the EU Member State concerned (Art. 6 (4) of the Recast Asylum Procedures Directive). RO depunere a unei cereri de protecție internațională N O P Q R SK podanie žiadosti o medzinárodnú ochranu S SL vložiti prošnjo za mednarodno zaščito SV lämna in ansökan om internationellt skydd NO fremme en søknad om internasjonal beskyttelse (b); søkje om internasjonalt vern (n) T KA საერთაშორისო დაცვის მოთხოვნის შესახებ U UK подання заяви про надання міжнародного захисту V განცხადების შეტანა HY միջազգային պաշտպանության դիմումի ներկայացնելը W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 371
long-stay visa BG виза за дългосрочно пребиваване CS dlouhodobé vízum DE Visum für den längerfristigen Aufenthalt (EU acquis); Langzeit-Visum EL θεώρηση εισόδου για διαμονή μακράς διαρκείας (EL); θεώρηση μακράς διάρκειας (CY) EN long-stay visa ES visado para estancia de larga duración ET pikaajaline viisa FI pitkäaikainen viisumi FR visa de long séjour GA víosa fadchuairte HR dugotrajna viza HU hosszú távú tartózkodásra jogosító vízum IT visto per soggiorno di lunga durata LT ilgalaikė viza LV ilgtermiņa vīza Definition(s) The authorisation or decision issued by one of the EU Member States in accordance with its national law or Union law required for entry for an intended stay in that EU Member State of more than three months. Source(s) Art. 2(m) of Regulation (EU) No 604/2013 (Dublin III Regulation) Broader term(s) visa Related term(s) airport transit visa short-stay visa EMN Asylum and Migration Classification 6.1.2 Visa policy Euro Voc Classification 2811 migration MT Viża ghal żjara / miġja / waqfa fit-tul NL visum voor verblijf van langere duur PL wiza długoterminowa PT visto de longa duração RO viză de lungă şedere SK dlhodobé vízum SL vizum za dolgoročno prebivanje SV visering för längre vistelse NO oppholdstillatelse (b); opphaldsløyve (n) KA გრძელვადიანი ვიზა UK довгострокова віза HY 372 երկարաժամկետ վիզա EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B long-term migrant BG дългосрочен мигрант CS dlouhodobý migrant DE langfristig aufhältiger Migrant / Langzeit-Migrant EL μετανάστης επί μακρόν διαμένων EN long-term migrant ES persona migrante de carácter permanente ET pikaajaliselt riigis viibiv sisserändaja FI pitkään oleskellut maahanmuuttaja FR migrant de longue durée GA imirceach fadtéarmach HR dugotrajni migrant HU huzamos tartózkodási céllal érkező migráns IT migrante di lungo periodo LT ilgalaikis migrantas LV ilgtermiņa migrants C D Definition(s) A person who moves to a country other than that of their usual residence for a period of at least a year (12 months), so that the country of destination effectively becomes their new country of usual residence. E Source(s) G Broader term(s) H Related term(s) I OECD Glossary of Statistical Terms migrant long-term migration short-term migrant F J EMN Asylum and Migration Classification K 3. Legal Migration Euro Voc Classification L 2811 migration MT Migrant(a) fit-tul / għal żmien twil M NL langverblijvende migrant / langdurig migrant PL migrant długookresowy N PT migrante de longa duração RO migrant pe termen lung O SK dlhodobý migrant SL migrant za daljše obdobje P SV långtidsmigrant NO migrant med langvarig opphold (b); migrant med langvarig opphald (n) Q KA გრძელვადიანი მიგრანტი R UK довгостроковий мігрант HY S երկարաժամկետ միգրացիա T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 373
long-term migration BG дългосрочна миграция CS dlouhodobá migrace DE langfristige Migration / Langzeit-Migration EL μακροχρόνια μετανάστευση EN long-term migration ES migración de larga duración Definition(s) Movement of individuals who change their country of usual residence for a period of at least one year, so that the country of destination effectively becomes their new country of usual residence. Source(s) FI pitkäaikainen maahanmuutto Derived by EMN from the UN Recommendations on Statistics of International Migration and OECD Glossary of Statistical Terms FR migration de longue durée Synonym(s) ET pikaajaline sisseränne GA imirce fhadtéarmach HR dugotrajna migracija permanent-type migration permanent migration HU huzamos tartózkodási célú migráció Broader term(s) IT migrazione di lungo periodo migration LT ilgalaikė migracija Related term(s) LV ilgtermiņa migrācija MT Migrazzjoni fit-tul NL langetermijnmigratie PL migracja długookresowa PT migração de longa duração RO migraţie pe termen lung SK dlhodobá migrácia SL migracije za daljše obdobje SV långtidsmigration NO langtidsmigrasjon KA გრძელვადიანი მიგრაცია UK довгострокова міграція HY 374 long-term migrant short-term migration temporary migration EMN Asylum and Migration Classification 3. Legal Migration Euro Voc Classification 2811 migration Note(s) Long-term migration’ and ‘permanent migration’ are often understood as quasi-synonyms. The Organisation for Economic Co-operation and Development (OECD) defines permanent migration as ‘a concept relating to undertaking migration with a view to, or which results in, settling on a permanent basis in the country of destination. երկարատեվ ներգաղթ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B long-term mobility BG дългосрочна мобилност CS dlouhodobá mobilita C D Definition(s) E ES movilidad de larga duración In the context of Directive 2016/801/EU (Recast Researcher’s Directive), the action of a third-country national, already authorised to stay in one EU Member State for the purposes of research or studies, staying in one or several second EU Member States for more than 180 days per EU Member State in order to carry out part of their research in any research organisation. ET pikaajaline liikuvus Source(s) H DE langfristige Mobilität EL μακροχρόνια κινητικότητα (EL); μακρά κινητικότητα (CY) EN long-term mobility FI pitkäaikainen liikkuvuus FR mobilité de longue durée GA soghluaisteacht fhadtéarmach HR dugoročna mobilnost HU hosszú távú mobilitás IT mobilità di lunga durata LT Ilgalaikis judumas LV ilgtermiņa mobilitāte Derived by EMN from Art. 29 of Directive 2016/801/EU (Recast Researcher’s Directive) Related term(s) G I J short-term mobility EMN Asylum and Migration Classification K 3.3 Migration for Study and Research Euro Voc Classification L 2811 migration MT Mobbilità fit-tul M NL langetermijnmobiliteit N PL długoterminowawa mobilność PT mobilidade de longa duração O RO mobilitate pe termen lung SK dlhodobá mobilita P SL dolgoročna mobilnost SV rörlighet för längre vistelse Q NO langvarig flytting KA გრძელვადიანი მობილობა R UK довгострокова мобільність HY F S երկարաժամկետ շարժունակություն T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 375
long-term resident BG дългосрочно пребиваващ CS dlouhodobě pobývající rezident DE langfristig Aufenthaltsberechtigter EL επί μακρών διαμένων EN long-term resident ES residente de larga duración Definition(s) A third-country national who has long-term resident status as provided for under Arts. 4 to 7 of Council Directive 2003/109/EC (Long Term Residents Directive) or as provided for under national legislation. Source(s) ET pikaajaline elanik Art. 2(b) of Council Directive 2003/109/EC (Long Term Residents Directive) FI pitkään oleskellut Related term(s) FR résident de longue durée GA cónaitheoir fadtéarmach HR osoba s dugotrajnim boravištem HU huzamos tartózkodási engedéllyel rendelkező személy IT soggiornante di lungo periodo right of residence EMN Asylum and Migration Classification 3. Legal Migration| 8.1 Right of residence, authorisation of stay/long-term visa, / residence permits Euro Voc Classification 2811 migration LT ilgalaikis gyventojas LV pastāvīgais iedzīvotājs MT Resident(a) fit-tul NL langdurig ingezeten onderdaan van een derde land / langdurig ingezetene PL rezydent długoterminowy PT residente de longa duração RO rezident pe termen lung SK osoba s dlhodobým pobytom Note(s) 1. EU Member States must recognise long-term resident status after five years of uninterrupted legal residence. This is however dependent upon the person having a stable and regular source of income, health insurance and, when required by the EU Member State, having complied with integration measures. The applicant must also not constitute a threat to public security or public policy. 2. Directive 2011/51/EU of 11 May 2011 amended Directive 2003/109/ EC (Long Term Residents Directive) to extend its scope of application to beneficiaries of international protection. 3. The UN Recommendations on Statistics on International Migration set one year of intended residence as the lower threshold. SL rezident za daljše obdobje SV varaktigt bosatt NO person med permanent oppholdtillatelse (b); person med permanent opphaldsløyve (n) KA გრძელვადიანი მობინადრე/მცხოვრები UK довгостроковий резидент HY 376 երկարաժամկետ բնակիչ/ռեզիդենտ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B loss of citizenship BG загуба на гражданство CS pozbytí státního občanství DE Verlust der Staatsangehörigkeit / Verlust der Staatsbürgerschaft EL απώλεια ιθαγένειας (EL); στέρηση ιθαγένειας, ιδιότητας του πολίτη (CY) C D Definition(s) Any mode of loss of the status as citizen of a country, voluntarily or involuntarily, automatically or by an act by the public authorities. Source(s) E F EN loss of citizenship Global Citizenship Observatory (GLOBALCIT): Glossary on Citizenship and Electoral Rights G ES pérdida de nacionalidad Synonym(s) ET kodakondsuse kaotamine loss of nationality H FI kansalaisuuden menettäminen Broader term(s) FR perte de la nationalité citizenship I GA cailleadh saoránachta Related term(s) acquisition of citizenship J HR gubitak državljanstva HU állampolgárság elvesztése Euro Voc Classification K IT perdita di cittadinanza LT pilietybės netekimas LV pilsonības zaudēšana MT Telf ta’ ċittadinanza 1236 rights and freedoms| 2811 migration L Note(s) M The main types of loss are renunciation, withdrawal and lapse of citizenship. NL verlies van het staatsburgerschap N PL utrata obywatelstwa O PT perda de nacionalidade RO pierderea cetăţeniei P SK strata štátneho občianstva SL izguba državljanstva SV förlust av medborgarskap Q NO tap av statsborgerskap (b); tap av statsborgarskap (n) R KA მოქალაქეობის დაკარგვა S UK втрата громадянства HY քաղաքացիության կորուստ T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 377
making an application for international protection BG подаване на молба за международна закрила CS podat žádost o mezinárodní ochranu Definition(s) DE einen Antrag auf internationalen Schutz stellen The expression of intent to apply for international protection. EL υποβολή αίτησης παροχής διεθνούς προστασίας Source(s) EN making an application for international protection ES expresar el deseo de solicitud de protección internacional ET soovi avaldamine rahvusvahelise kaitse saamiseks FI kansainvälistä suojelua koskevan hakemuksen tekeminen FR présenter une demande de protection internationale GA iarratas ar chosaint idirnáisiúnta a dhéanamh HR namjera za podnošenje zahtjeva za međunarodnu zaštitu HU nemzetközi védelem iránti szándék kinyilatkoztatása IT presentazione di una domanda di protezione internazionale LT prašymo dėl tarptautinės apsaugos išreiškimas (EU acquis); prašymo dėl prieglobsčio suteikimo išreiškimas LV izteikt vēlmi iesniegt starptautiskās aizsardzības pieteikumu MT Tressiq / Preżentazzjoni ta’ applikazzjoni għallprotezzjoni internazzjonali NL een verzoek om internationale bescherming doen PL złożenie wniosku o ochronę międzynarodową (wyrażenie woli ubiegania się o ochronę międzynarodową) Derived by EMN from Art. 6 (1) and 6 (5) of Directive 2013/32/EU (Recast Asylum Procedures Directive) and EASO: Background document for Member States on application of Art. 6 of the recast Asylum Procedures Directive, 2015 Related term(s) access to the procedure for international protection lodging an application for international protection EMN Asylum and Migration Classification 6.2.1 Access to the international protection procedure Euro Voc Classification 1011 European Union law| 2811 migration Note(s) 1. Expressing the wish to apply for international protection, even in an indirect/non explicit manner, constitutes making an application. 2. Since 20 July 2015, EU Member States have had to register all applications made as well as those lodged. This is to ensure effective monitoring of access to procedure. The EUAA, formerly EASO, has been gathering data on applications made under its Early Warning and Preparedness System (EPS) since 15 September 2015. 3. Third-country nationals and stateless persons who have expressed their wish to apply for international protection are applicants for international protection, who should therefore comply with the obligations, and benefit from the rights, outlined in Directive 2013/32/EU (Recast Asylum Procedures Directive) and Directive 2013/33/EU (Recast Reception Conditions Directive) . PT apresentação de pedido de proteção internacional RO prezentare a unei cereri de protecție internațională SK požiadanie o medzinárodnú ochranu SL izraziti namen za vložitev prošnje za mednarodno zaščito / izraziti namero za vložitev prošnje za mednarodno zaščito SV ansöka om internationellt skydd NO søke om internasjonal beskyttelse (b); søkje om internasjonalt vern (n) KA საერთაშორისო დაცვის მოთხოვნა UK складання заяви про надання міжнародного захисту HY 378 միջազգային պաշտպանության դիմում ներկայացնել EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B managed migration BG управление на миграционните процеси CS řízená migrace C D Definition(s) ES gestión integral de la migración An approach used by the EU and EU Member States to structure the management of all aspects of migration into and within the EU of both third-country nationals and EU nationals, particularly the entry, admission, residence, integration and return, as well as of refugees and others in need of protection. ET juhitud ränne Source(s) DE gesteuerte Migration EL επιλεκτική μετανάστευση EN managed migration FI hallittu maahanmuutto Developed by EMN FR gestion des migrations Synonym(s) GA imirce bhainistithe migration management HR upravljanje migracijama Related term(s) HU kezelt migráció / irányított migráció IT migrazione gestita LT valdoma migracija LV pārvaldīta migrācija MT Ġestjoni ta’ flussi migratorji NL gereguleerde migratie F G H I J economic migrant economic migration forced migration quota K L Euro Voc Classification 2811 migration M PL migracja zarządzana N PT gestão de migrações RO migrație gestionată / migraţie controlată O SK riadená migrácia SL upravljanje migracij P SV reglerad migration NO styrt migrasjon Q KA მართული მიგრაცია R UK регульована міграція HY E կառավարվող միգրացիա S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 379
mandate refugee BG бежанец по мандата на Върховния комисар на ООН за бежанците (ВКБООН) CS mandátní uprchlík DE Mandatsflüchtling EL πρόσφυγας εντολής EN mandate refugee ES refugiado bajo mandato ET mandaadipagulane FI mandaattipakolainen FR réfugié relevant du mandat du HCR GA dídeanaí de réir sainordú HR mandatna izbjeglica HU mandátumos menekült IT rifugiato ex mandato LT pabėgėlis pagal mandatą LV UNHCR mandāta bēglis MT rifuġjat f’qafas ta’ mandat NL mandaatvluchteling Definition(s) A person who meets the criteria of the UNHCR Statute and qualifies for the protection of the UN provided by the United Nations High Commissioner for Refugees (UNHCR), regardless of whether or not they are in a country that is a party to the Geneva Refugee Convention and Protocol, or whether or not they have been recognised by the host country as a refugee under either of these instruments. Source(s) Derived by EMN from IOM Glossary on Migration, 2019. Broader term(s) refugee Related term(s) Convention refugee EMN Asylum and Migration Classification 4.1.1 Refugee protection Euro Voc Classification 1231 international law| 2811 migration PL uchodźca mandatowy PT refugiado mandato RO refugiat sub mandat UNHCR SK mandátny utečenec SL mandatni begunec SV mandatflykting NO overføringsflyktning KA მანდატით განსაზღვრული ლტოლვილი UK мандатний біженець HY 380 մանդատի ներքո փախստական EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 381
manifestly unfounded application for international protection BG явно неоснователна молба за международна закрила LV acīmredzami nepamatots starptautiskās aizsardzības pieteikums CS zjevně nedůvodná žádost o mezinárodní ochranu MT applikazzjoni manifestament / bans bla bażi għall-protezzjoni internazzjonali DE offensichtlich unbegründeter Antrag auf internationalen Schutz EL προδήλως αβάσιμη αίτηση διεθνούς προστασίας EN manifestly unfounded application for international protection ES solicitud de protección internacional manifiestamente infundada ET selgelt põhjendamatu rahvusvahelise kaitse taotlus FI ilmeisen perusteeton kansainvälistä suojelua koskeva hakemus FR demande de protection internationale manifestement infondée GA HR očito neosnovan zahtjev za međunarodnu zaštitu HU nyilvánvalóan megalapozatlan nemzetközi védelem iránti kérelem IT domanda di protezione internazionale manifestamente infondata LT akivaizdžiai nepagrįstas tarptautinės apsaugos prašymas (EU acquis); akivaizdžiai nepagrįstas prašymas suteikti prieglobstį 382 NL kennelijk ongegrond verzoek om internationale bescherming PL bezpodstawny wniosek o udzielenie ochrony międzynarodowej PT requerimento manifestamente infundado de proteção internacional RO cerere vădit nefondată de protecție internațională SK zjavne neopodstatnená žiadosť o medzinárodnú ochranu / zjavne neopodstatnená žiadosť o udelenie medzinárodnej ochrany SL očitno neutemeljena prošnja za mednarodno zaščito SV uppenbart ogrundad ansökan om internationellt skydd NO Klart grunnløs søknad om internasjonal beskyttelse (b); Klart grunnlaus søknad om internasjonalt vern (n) KA აშკარად დაუსაბუთებელი განცხადება საერთაშორისო დაცვის მოთხოვნის შესახებ UK явно необґрунтована заява про надання міжнародного захисту HY EMN ASYLUM AND MIGRATION GLOSSARY 10.0 միջազգային պաշտպանության ակնհայտորեն անհիմն դիմում
A B C Definition(s) In the global context, an application which is a) not related to the criteria for granting refugee status laid down in Art. 1(A2) of the Geneva Refugee Convention and Protocol nor to other criteria justifying the granting of asylum or b) which is clearly fraudulent as it is based on a deliberate attempt to deceive the authorities determining refugee status. In the EU context, an unfounded application for international protection that is considered under national legislation of EU Member States to be manifestly unfounded in one of the following circumstances: - the applicant has only raised issues that are not relevant for the qualification as a beneficiary of international protection; - the applicant is from a safe country of origin; - the applicant is, for serious reasons, considered a danger to the national security or public order or - the application is based on deliberate deception or an abuse of the procedure for international protection as further described in the circumstances c-i listed in Art. 31(8) of Directive 2013/32/EU (Recast Asylum Procedures Directive) Source(s) Global context: Derived by EMN from UNHCR: The Problem of Manifestly Unfounded or Abusive Applications for Refugee Status or Asylum, 20 October 1983, UNHCR Executive Committee Conclusion No. 30 (XXXIV) of 1983 and UNHCR: Position on Manifestly Unfounded Applications for Asylum, 1 December 1992 EU-context: Derived by EMN from Art. 31(8) and 32 of Directive 2013/32/EU (Recast Asylum Procedures Directive) D Note(s) 1. The United Nations High Commissioner for Refugees (UNHCR) refers in its Executive Committee Conclusion No. 30 that procedures for applications considered to be manifestly unfounded should include necessary procedural safeguards including preliminary counselling in an appropriate language; full personal interview by an qualified official; responsibility of the competent asylum authority for establishing the manifestly unfounded character of the application; ability to seek review of negative decisions. 2. The further circumstances according to Art. 31(8) c- i of Directive 2013/32/EU (Recast Asylum Procedures Directive) are: c) the applicant has misled the authorities by presenting false information/documents or by withholding relevant information/documents with respect to their identity and/or nationality that could have had a negative impact on the decision; d) it is likely that the applicant has, in bad faith, destroyed or disposed of an identity or travel document that would have helped establish their identity or nationality; e) the applicant has made clearly inconsistent and contradictory, clearly false or obviously improbable representations which contradict sufficiently verified country of origin information (COI), thus making their claim clearly unconvincing in relation to whether they qualify as a beneficiary of international protection; f) the applicant has introduced a subsequent application for international protection that is not inadmissible g) the applicant is making an application merely in order to delay or frustrate the enforcement of an earlier or imminent decision which would result in their removal; h) the applicant entered the territory of the EU Member State unlawfully or prolonged their stay unlawfully and, without good reason, has either not presented themselves to the authorities or not made an application for international protection as soon as possible, given the circumstances of their entry; i) the applicant refuses to comply with an obligation to have their fingerprints taken in accordance with Regulation (EU) No 603/2013 (Eurodac-Regulation) for the comparison of fingerprints for the effective application of Regulation (EU) No 604/2013 (Dublin III Regulation) 3. Applications for international protection in the above circumstances that are defined under national legislation as ‘manifestly unfounded’ may be considered under accelerated procedures and/or conducted at the border or in transit zones, in accordance E F G H I J K L M N O P Q R S T Broader term(s) U unfounded application for international protection Related term(s) V accelerated international protection procedure EMN Asylum and Migration Classification W 6.2 Procedure for international protection/Refugee status determination X Euro Voc Classification 1011 European Union law| 2811 migration Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 383
marriage of convenience BG фиктивен брак CS účelové manželství DE Scheinehe EL γάμος συμφέροντος EN marriage of convenience ES matrimonio de complacencia ET fiktiivabielu / näiline abielu FI lumeavioliitto Definition(s) A marriage contracted for the sole purpose of enabling the person concerned to enter or reside in an EU Member State. Source(s) Art. 16 (2b) of Council Directive 2003/86/EC (Family Reunification Directive) Related term(s) HR brak iz koristi adoption of convenience civil partnership of convenience false declaration of parenthood partnership of convenience HU érdekházasság EMN Asylum and Migration Classification FR mariage de complaisance GA pósadh áisiúlachta IT matrimonio fittizio LT fiktyvi santuoka LV fiktīva laulība 14. Factors and Impacts of Migration Euro Voc Classification 2806 family| 2811 migration MT Żwieġ ta’ konvenjenza / għall-konvenjenza NL schijnhuwelijk PL małżeństwo zawarte w celu obejścia przepisów umożliwiających legalizację pobytu / małżeństwo fikcyjne Note(s) For further information, see EMN: Marriages of convenience and false declarations of parenthood, 2012. PT casamento de conveniência RO căsătorie de convenienţă SK účelové manželstvo SL navidezna zakonska zveza / zakon iz koristoljubja SV skenäktenskap NO proformaekteskap KA ფიქციური ქორწინება UK фіктивний шлюб HY 384 շահի վրա հիմնված ամուսնություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B mass influx BG масово навлизане CS hromadný příliv DE Massenzustrom EL μαζική εισορρή EN mass influx ES afluencia masiva ET massiline sisseränne C D Definition(s) Arrival in the Community of a large number of displaced persons, who come from a specific country or geographical area, whether their arrival in the Community was spontaneous or aided, for example through an evacuation programme. Source(s) FI joukoittainen maahantulo Art. 2(d) of Council Directive 2001/55/EC (Temporary Protection Directive) FR afflux massif Related term(s) E F G H I GA mórphlódú isteach temporary protection HR masovni priljev EMN Asylum and Migration Classification HU tömeges beáramlás 4.3 Temporary protection J IT afflusso massiccio Euro Voc Classification K LT masinis srautas (EU acquis); antplūdis 2811 migration L LV masveida pieplūdums MT Influss tal-massa / ta’ massa M NL massale toestroom / massale instroom PL masowy napływ N PT afluxo maciço RO aflux masiv O SK hromadný prílev SL množični prihod P SV massiv tillströmning NO massetilstrømning (b); massetilstrøyming (n) Q KA მასობრივი შემოდინება R UK масовий наплив HY զանգվածային ներհոսք S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 385
material reception conditions BG материални условия на приемане CS materiální podmínky přijetí DE materielle Aufnahmebedingungen EL υλικοί όροι υποδοχής EN material reception conditions ES condiciones materiales de acogida ET materiaalsed vastuvõtutingimused Definition(s) Subsistence support provided by an EU Member State to an applicant for international protection consisting of housing, food and clothing, in kind or as financial allowances or in vouchers, or a combination of the three, and a daily expenses allowance. Source(s) FI aineelliset vastaanotto-olosuhteet Derived by EMN from Art. 2(g) of Directive 2013/33/EU (Recast Reception Conditions Directive) FR conditions matérielles d’accueil Broader term(s) GA dálaí ábhartha glactha reception conditions HR materijalni uvjeti prihvata EMN Asylum and Migration Classification HU a befogadás anyagi feltételei IT condizioni materiali di accoglienza LT materialinės priėmimo sąlygos LV uzņemšanas materiālie nosacījumi MT Kondizzjonijiet materjali tal-akkoljenza NL materiële opvangvoorzieningen PL materialne warunki przyjmowania PT condições materiais de acolhimento 4.4 Reception and Accommodation of Applicants for international protection and other refugees Euro Voc Classification 2811 migration Note(s) The material reception conditions listed in the Reception Conditions Directive are binding on all EU Member States. In addition, they may introduce or maintain more favourable provisions for third-country nationals and stateless persons, such as medical or psychological care. RO condiţii materiale de recepţie SK materiálne prijímacie podmienky (EU acquis); materiálne podmienky prijímania SL materialni pogoji za sprejem SV materiella mottagningsvillkor NO materielle mottaksforhold (b); materielle mottakstilhøve (n) KA მიღების მატერიალური პირობები UK матеріальні умови прийому HY 386 ընդունելության նյութական պայմաններ Միջազգային պաշտպանության համար դիմողին ԵՄ անդամ պետության կողմից տրամադրվող կենսապահովումը EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 387
migrant BG мигрант CS migrant Definition(s) LT migrantas In the global context, a person who moves away from their place of usual residence, whether within a country or across an international border, temporarily or permanently, voluntarily or involuntarily, and for a variety of reasons. In the EU/EFTA context, a person who either: (i) establishes their usual residence in the territory of an EU/EFTA Member State for a period that is, or is expected to be, of at least 12 months, having previously been usually resident in another EU/EFTA Member State or a third country; or (ii) having previously been usually resident in the territory of the EU/EFTA Member State, ceases to have their usual residence in the EU/EFTA Member State for a period that is, or is expected to be, of at least 12 months. LV migrants Source(s) DE Migrant EL μετανάστης EN migrant ES persona migrante ET sisserändaja FI siirtolainen/maahanmuuttaja FR migrant GA imirceach HR migrant HU migráns IT migrante MT Migrant/a NL migrant PL migrant PT migrante RO migrant SK migrant SL migrant SV migrant NO migrant KA მიგრანტი UK мігрант HY միգրանտ General context: Derived by EMN from IOM Glossary on Migration, 2019 EU/EFTA context: Derived by EMN from the definition of the terms immigration in Art. 2(b) and emigration in Art. 2(c) of Regulation (EC) No 862/2007 (Migration Statistics Regulation) and the term long-term migrant in the Glossary of the UN Recommendations on Statistics of International Migration, p. 94 Narrower term(s) economic migrant emigrant environmental migrant forced migrant immigrant long-term migrant short-term migrant Related term(s) applicant for international protection asylum seeker displaced person refugee EMN Asylum and Migration Classification 1. Framework Concepts on Migration (including root causes of migration Euro Voc Classification 2811 migration 388 EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1.There is no universal accepted definition of migrant, nor is it defined under international or EU law. Therefore, the definition of International Organization of Migration (IOM) as the authority on all issues of migration is used. 2. IOM defines migrant in the broadest way in its Glossary on Migration 2019 as an umbrella term encompassing international migration (movement across an international border) and internal migration (as movement within a country), covering all causes of migration (migration because of political persecution, conflicts, economic problems, environmental degradation or a combination of these reasons or migration in search of better economic conditions or conditions of survival or well-being, or other motives such as family reunification) and different means (legal or irregular migration) and irrespective of the duration. 3. In the EU/EFTA context, however, migration is understood as international migration, the definition is based on the definition of the UN recommendations on Statistics of International Migration which are referred to in Regulation (EC) No 862/2007 (Migration Statistics Regulation). The Migration Statistics Regulation differentiates between immigration (Art. 2b) and emigration (Art. 2c) as well as between immigrant (Art. 2f) and emigrant (Art. 2g). 4. Under the UN definition, those travelling for shorter periods as tourists and business persons would not be considered migrants. However, common usage includes certain kinds of short-term migrants such as seasonal workers. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 389
Migrant Integration Policy Index (MIPEX) BG Индекс за политиката на интеграция на мигрантите (MIPEX) Definition(s) DE Index für die Integration von Migranten / Integrationsindex für Migranten A tool which measures policies to integrate migrants in more than 50 countries across all continents, including Europe with all EU Member States and several EU associated countries. EL Δείκτης Πολιτικής Ένταξης Μεταναστών (MIPEX) Source(s) CS Index integračních politik migrantů (MIPEX) EN Migrant Integration Policy Index (MIPEX) MIPEX-Website ES Índice de Políticas de Integración de la Migración (MIPEX) Synonym(s) ET sisserändajate integratsioonipoliitika indeks (MIPEX) Broader term(s) FI Maahanmuuttajien kotoutumisindeksi (MIPEX) FR index des politiques d’intégration des migrants (MIPEX) GA Innéacs Beartas Imeasctha Imirceach HR Indeks razvijenosti politika integracije migranata (MIPEX) HU Migráns Integrációs Szakpolitikai Index IT LT Migrantų integracijos politikos indeksas (MIPEX) LV Migrantu integrācijas politikas indekss (MIPEX) MT Indiċi tal-Integrazzjoni dwar il-Politika tal-Migrazzjoni (MIPEX) NL Migrant Policy Integration Index (MIPEX) PL Indeks Polityki Integracji Migrantów (MIPEX) PT Índice de Políticas de Integração de Migrantes RO SK Index politík integrácie migrantov / Index integračných politík (MIPEX) MIPEX integration Related term(s) integration indicators Zaragoza Declaration on Integration EMN Asylum and Migration Classification 9. Integration Euro Voc Classification 2811 migration Note(s) 1.The MIPEX encompasses 167 policy indicators in eight different policy areas (labour market mobility, family reunion, education, political participation, long-term residence, access to nationality, anti-discrimination and health) which reflect the multi-dimensional picture of migrants’ opportunities to participate in society. 2.The MiPEX was first published in 2004 as the European Civic Citizenship and Inclusion Index. 3. The index is a useful tool to evaluate and compare what governments are doing to promote the integration of migrants in the host countries analysed. 4. For more information, including the full list of participating countries, see the website of MIPEX. SL Indeks politike vključevanja migrantov (MIPEX) SV det integrationspolitiska indexet MIPEX NO MIPEX – en internasjonal integreringsindeks som sammenligner og rangerer integreringspolitikk (b); MIPEX – ein internasjonal integreringsindeks som samanliknar og rangerer integreringspolitikk (n) KA მიგრანტთა ინტეგრაციის პოლიტიკის ინდექსი (MIPEX) UK Індекс політики інтеграції іммігрантів (MIPEX) HY 390 Միգրացիոն Ինտեգրման Քաղաքականության Ցուցիչ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B migrant stock BG брой на мигрантите CS počet imigrantů (stav k) DE Anzahl der Einwanderer EL μεταναστευτικό απόθεμα / απόθεμα πληθυσμού μεταναστών EN migrant stock ES población inmigrante ET sisserändajate arv FI maahanmuuttajaväestön määrä FR stock de migrants GA lion na n-imirceach HR broj migranata HU migráns népességszám IT stock di migranti LT migrantų skaičius LV migrantu skaits (1. janvārī) MT Rendikont tal-migranti C D Definition(s) E The number of migrants in a given area on a certain date (e.g. 1 January or 31 December) of the year in question. F Source(s) Derived by EMN from Eurostat: Working Papers and Studies (3/2003/E/no25) G Synonym(s) H immigrant population stock of migrants I Broader term(s) population stock stock of foreigners J Related term(s) K Euro Voc Classification L foreign population of a country 2811 migration M NL migrant stock (no usual translation) N PL populacja migrantów w danym momencie PT stock migratório O RO stoc de migranţi SK stav migrantov P SL število migrantov SV antal migranter Q NO antall registrert bosatte innvandrere (b); tal på registrert busette innvandrarar (n) R KA მიგრანტთა ჯგუფი UK чисельність мігрантів HY S միգրանտների թվաքանակ T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 391
migrant worker BG работник мигрант CS pracovní migrant Definition(s) DE Arbeitsmigrant / Wanderarbeiter / Wanderarbeitnehmer A person who is to be engaged, is engaged or has been engaged in a remunerated activity in a state of which they are not nationals. EL εργαζόμενος μετανάστης Source(s) EN migrant worker ES trabajador migrante ET võõrtöötaja FI siirtotyöläinen FR travailleur migrant GA oibrí imirceach HR radnik migrant HU migráns munkavállaló IT lavoratore migrante LT migrantas darbuotojas LV darba ņēmējs migrants MT ħaddiem migrant NL arbeidsmigrant / buitenlandse werknemer PL pracownik migrujący PT trabalhador migrante RO lucrător migrant / muncitor migrant Art. 2(1) of the UN Convention on the Protection of All Migrant Workers and Members of their Families Synonym(s) foreign worker labour migrant Broader term(s) economic migrant Narrower term(s) contract migrant worker highly qualified migrant Related term(s) guest worker labour migration EMN Asylum and Migration Classification 3.1 Migration for Economic Purposes Euro Voc Classification 2811 migration| 4406 employment SK migrujúci pracovník / pracovný migrant SL delavec migrant SV migrantarbetare NO arbeidsmigrant KA შრომითი მიგრანტი UK трудовий мігрант HY 392 միգրանտ աշխատող Note(s) 1. The Organisation for Economic Co-operation and Development (OECD) defines a migrant worker as ‘a foreigner admitted by the receiving state for the specific purpose of exercising an economic activity remunerated from within the receiving country. Their length of stay is usually restricted as is the type of employment they can hold’. 2. For the purpose of the EMN the UN definition is prefered as it is more common in literature and more comprehensive since it specifically includes those migrant workers who may currently be out of work, but had been working earlier. The Convention also includes self-employed workers. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 393
migration BG миграция CS migrace DE Migration EL μετανάστευση EN migration ES migración ET ränne FI muuttoliike / maahanmuutto FR migration GA imirce HR migracije HU migráció IT migrazione LT migracija LV migrācija MT Migrazzjoni Definition(s) In the global context, movement of persons away from their place of usual residence, either across an international border or within a State, temporarily or permanently, voluntarily or involuntarily, and for a variety of reasons. In the EU/EFTA context, the action by which a person either: (i) establishes their usual residence in the territory of an EU/EFTA Member State for a period that is, or is expected to be, of at least 12 months, having previously been usually resident in another EU/EFTA Member State or a third country; or (ii) having previously been usually resident in the territory of an EU/EFTA Member State, ceases to have their usual residence in that EU/EFTA Member State for a period that is, or is expected to be, of at least 12 months. Source(s) SV migration Global context: Derived by EMN from IOM Glossary on Migration, 2019 EU/EFTA context: Derived by EMN from the definition of the terms ‘immigration’ in Art. 2(b) and ‘emigration’ in Art. 2(c) of Regulation (EC) No 862/2007 (Migration Statistics Regulation) and the term ‚long-term migrant’ in the Glossary of the UN Recommendations on Statistics of International Migration, p. 94 NO migrasjon Narrower term(s) NL migratie PL migracja PT migração RO migraţie SK migrácia SL migracije KA მიგრაცია UK міграція HY միգրացիա economic migration emigration forced migration immigration irregular migration legal migration long-term migration Related term(s) displacement migrant EMN Asylum and Migration Classification 1. Framework Concepts on Migration (including root causes of migration Euro Voc Classification 2811 migration 394 EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. There is no universal accepted definition of migration, nor is it defined under international or EU law. Therefore, the definition of the International Organization of Migration (IOM) as the authority on all issues of migration is used. 2. The IOM defines migration in the broadest way in its Glossary on Migration 2019 as an umbrella term, encompassing any kind of movement of people, whatever its length, composition and causes. It includes all forms of migration (international migration (movement across an international border) and internal migra-tion (movement within a country), voluntary/forced migration, long-term/short-term migration), different motives for migration (migration because of political persecution, conflicts, economic problems, environmental degradation or a combination of these reasons or migration in search of better economic conditions or conditions of survival or well-being, or other motives such as family reunification) and irrespective of the means used to migrate (legal/ irregular migration). 3. In the EU/EFTA context, however, migration is understood as international migration, the definition is based on the definition of the UN recommendations on Statistics of International Migration which are referred to in Regulation (EC) No 862/2007 (Migration Statistics Regulation). The Migration Statistics Regulation differentiates between immigration (Art. 2b) and emigration (Art. 2c). Under the UN, the definition ‹movements for shorter periods› would not be considered migration. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 395
migration crisis BG миграционна криза CS migrační krize DE Migrationskrise EL μεταναστευτική κρίση EN migration crisis ES crisis migratoria ET rändekriis FI muuttoliikekriisi / maahanmuuttokriisi FR crise migratoire GA géarchéim imirce HR migracijska kriza HU migrációs válság IT crisi migratoria LT migracijos krizė LV migrācijas krīze MT Kriżi migratorja NL migratiecrisis PL kryzys migracyjny PT crise migratória RO criza mi-grațională SK migračná kríza SL migracijska kriza SV migrationskris NO migrasjonskrise KA მიგრაციული კრიზისი UK міграційна криза HY միգրացիոն ճգնաժամ Definition(s) In the EU context, a situation of crisis that is either caused by a) an exceptional situation of mass influx of thirdcountry nationals or stateless persons arriving in an EU Member State or disembarked on its territory following search and rescue (SAR) operations, being of such a scale and nature, taking into account, inter alia, the population, GDP and geographical specificities, including the size of the territory of the EU Member State concerned, that it renders the well-prepared EU Member State’s asylum, reception or return system nonfunctional such that there may be serious consequences for the functioning of the Common European Asylum System (CEAS) of the Common Framework as set out in the Asylum and Migration Management Regulation; or b) a situation of instrumentalisation where a third country or non-state actor encourages or facilitates the movement of third-country nationals and stateless persons to the external EU borders or to an EU Member State, with the aim of destabilising the European Union or an EU Member State where such actions are liable to put at risk essential functions of an EU Member State, including the maintenance of law and order or the safeguard of its national security. Source(s) Art. 1(2) of the Proposal for a Regulation addressing situations of crisis and force majeure in the field of migration and asylum - Council of the European Union: Mandate for negotiations with the European Parliament, 4 October 2023 Related term(s) migratory pressure New Pact on Migration and Asylum EMN Asylum and Migration Classification 2.2 EU (e.g. Common European Asylum System, Qualification Directive, European Agenda for Migration) Euro Voc Classification 10 European Union| 1011 European Union law| 2811 migration 396 EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. The New Pact on Migration and Asylum consists of a set of legislative proposals, including the proposal for a Regulation addressing situations of crisis and force majeure in the field of migration and asylum. In a crisis situation or in cases of force majeure (e.g. pandemics, natural disasters), EU Member States may be authorised by the Council to apply special rules on asylum and return procedures, in accordance with the principles of necessity and proportionality and in full respect of fundamental rights. They may also request solidarity contributions, in the form of: ƒ the relocation of applicants or beneficiaries of international protection from the EU Member State in a crisis situation to contributing Member States ƒ responsibility offsets, i.e. the supporting EU Member State would take over the responsibility to examine applications for international protection with a view to relieve the EU Member State that finds itself in a crisis situation; ƒ financial contributions or alternative solidarity measures. 2. The definition of migration crisis in the Proposal of the Crisis and Force Majeure Regulation refers to two different crisis situations, it reflects the current wording following negotiations in the Council of the European Union and may therefore be subject to changes during the further legislative process. It is provisional, which can also be seen in the fact that the earlier version of the definition part (a) only referred to irregular migration. The term has been included in the glossary because of its importance for further discussions in order to be able to conduct these discussions on a common basis. 3. The refugee crisis of 2015 (sometimes called the migrant crisis or the migrant and refugee crisis) is mentioned in the proposal as one of the drivers behind the need for new legislation. However, the term migration crisis does not refer to the events of 2015, but aims at any forthcoming crises. 4. There is no internationally or universally accepted definition of the term migration crisis. The International Organization for Migration (IOM) has developed a Migration Crisis Operational Framework (MCOF), for more information see IOM: Addressing the mobility dimensions of crisis. IOM defines ‘migration crises’ in its Glossary on Migration 2019 as follows: “the complex and often large-scale migration flows and mobility patterns caused by a crisis which typically involve significant vulnerabilities for individuals and affected communities and generate acute and longer-term migration management challenges. A migration crisis may be sudden or slow in onset, can have natural or man-made causes, and can take place internally or across borders.” 5. In the EU context, the terms migration crisis and migratory pressure both refer to situations involving a considerable increase in the numbers of migrants arriving in an EU Member State. However, the situations differ mainly ƒ in the scale (a migration crisis is an “exceptional situation of mass influx”›; migratory pressure refers to “a large number of arrivals or a risk of such arrivals”) and ƒ in the impact on the EU Member State and its migration authorities (a migration crisis can render the national system “non-functional’ and potentially affect the CEAS, whereas migratory pressure places a “burden” on an EU Member State’s system to manage the situation). By all accounts, a migration crisis is a situation of far more gravity than migratory pressure and it can also be caused by instrumentalisation. The classification as a migration crisis or migratory pressure will lead to the application of different legal regimes. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 397
migration flow BG миграционен поток CS migrační tok DE Wanderungsbewegung / Migrationsbewegung EL μεταναστευτική ροή EN migration flow ES flujo migratorio ET rändevoog FI muuttovirta FR flux migratoire GA sreabhadh imirce HR migracijski tok HU migrációs áramlás IT flusso migratorio LT migracijos srautas LV migrācijas plūsma Definition(s) The number of migrants crossing a boundary, within a specific time period, for the purpose of establishing residence. Source(s) Developed by EMN Synonym(s) migratory flow Related term(s) crude rate of net migration mixed migration flow net migration population stock total migration EMN Asylum and Migration Classification MT Nixxiegħa migratorja 1. Framework Concepts on Migration (including root causes of migration NL migratiestroom Euro Voc Classification PL strumień migracyjny PT fluxo migratório RO flux de migraţie SK migračný tok SL migracijski tok SV migrationsströmmar NO migrasjonsstrøm (b); migrasjonsstraum (n) 2811 migration Note(s) 1. The boundary can range from within national borders, within the EU and international boundaries, and can range from international migration flows (crossing national borders) and internal migration flows (within the same national border). 2. UN statistics in particular also refer to ‘inflows’ (flow of migrants entering into a particular boundary) and ‘outflows’ (flow of migrants leaving a particular boundary). KA მიგრაციული ნაკადი UK міграційний потік HY 398 միգրացիոն հոսք EMN ASYLUM AND MIGRATION GLOSSARY 10.0
migration management support team BG екип за подкрепа при управлението на миграцията A B C D Definition(s) ES equipo de apoyo a la gestión de la migración Team of experts which provides technical and operational reinforcement to EU Member States at hotspot areas and which is composed of experts deployed from EU Member States by the European Border and Coast Guard Agency (Frontex) and by the European Union Agency for Asylum (EUAA), the European Union Agency for Law Enforcement Cooperation (Europol) or other relevant EU agencies. ET rände haldamise tugirühm Source(s) CS podpůrný tým pro řízení migrace DE Team zur Unterstützung der Migrationsverwaltung EL ομάδα στήριξης για τη διαχείριση των μεταναστευτικών ροών EN migration management support team FI maahanmuuton hallinnan tukitiimi FR équipe d’appui à la gestion des flux migratoires GA Foireann Tacaíochta do Bhainistiú na hImirce HU Migrációkezelést Támogató Csapat IT Squadra di sostegno per la gestione della migrazione LT migracijos valdymo rėmimo grupė LV migrācijas pārvaldības atbalsta vienība J Narrower term(s) K Euro Voc Classification L hotspot area M National experts (deployed by the agencies) can also be part of the team. The composition and expertise of the Support Teams are tailor-made to the specific situation and needs at the hotspot. PL Zespół ds. Wsparcia Zadządzania Migracjami PT equipa de apoio à gestão dos fluxos migratórios RO echipă de sprijin pentru gestionarea migrației N O P SK podporný tím pre riadenie migrácie SL Podporna skupina za upravljanje migracij Q SV stödgrupp för migrationshantering NO støttegruppe for arbeid med innvandringsregulering R KA მიგრაციის მართვის მხარდაჭერის ჯგუფი UK команда підтримки управління міграцією HY H Broader term(s) Note(s) NL ondersteuningsteam voor migratiebeheer G I 1011 European Union law| 2811 migration MT Tim ta’ appoġġ għall-immaniġjar tal-migrazzjoni F Art. 2(19) of Regulation (EU) No 2019/1896 (European Border and Coast Guard Regulation) hotspot approach HR tim za pružanje potpore upravljanju migracijama E S միգրացիայի կառավարման աջակցող թիմ T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 399
Migration Preparedness and Crisis Blueprint BG подробен план за подготвеност и кризи в областта на миграцията CS plán pro připravenost na migraci a pro migrační krize DE Vorsorge- und Krisenplan für Migration EL Σχέδιο στρατηγικής για την ετοιμότητα αντιμετώπισης και τη διαχείριση μεταναστευτικών κρίσεων EN Migration Preparedness and Crisis Blueprint ES Plan Rector de Preparación y Gestión de Crisis Migratorias MT Tlestija għall-Migrazzjoni u Pjan Iddettaljat għall-Kriżijiet / Blueprint dwar it-Tħejjija għallMigrazzjoni u l-Ġestjoni tal-Kriżijiet tal-Migrazzjoni NL Blauwdruk paraatheid en crisisbeheer in verband met migratie PL Migration Preparedness and Crisis Blueprint PT Plano de preparação para a migração e gestão de crises ET rändevaldkonna valmisoleku- ja kriisikava RO Planul de pregătire în materie de migrație și de criză / Planul de acțiune în vederea pregătirii pentru situații de criză legate de migrație și a gestionării acestora FI muuttoliikettä koskeva varautumis- ja kriisisuunnitelma SK Koncepcia pripravenosti a krízového riadenia v oblasti migrácie FR Plan de préparation et de gestion de crise en matière de migration SL načrt za pripravljenost na migracije in migracijske krize GA an Treoirphlean um Ullmhachta agus Géarchéimeanna Imirce HR Plan za pripravnost i upravljanje krizama u području migracija HU migrációs felkészültségi és válságkezelési terv IT Programma di preparazione e di risposta alle crisi LT Migracinės parengties ir migracijos krizių valdymo planas LV Migrācijas sagatavotības un krīzes plāns 400 SV beredskaps-och krisplan för migration NO Beredskapsplan for økte ankomster og andre ekstraordinære hendelser (b); Beredskapsplan for auka innkomstar og andre ekstraordinære hendingar (n) KA მიგრაციული პროცესებისთვის მზადყოფნისა და კრიზისულ ვითარებაში კოორდინაციის მექანიზმი UK План готовності до міграції та кризових ситуацій HY EMN ASYLUM AND MIGRATION GLOSSARY 10.0 միգրացիոն ճգնաժամերի պատրաստվածության և կառավարման ծրագիր
A B C Definition(s) Operational framework for monitoring and anticipating migration flows and migration situations, building resilience as well as organising a coordinated response to a migration crisis. Source(s) Recital 11 of European Commission: Recommendation (EU) 2020/1366 on an EU mechanism forpreparedness and management of crises related to migration (Migration Preparedness and Crisis Blueprint Recommendation) EMN Asylum and Migration Classification 2.2 EU (e.g. Common European Asylum System, Qualification Directive, European Agenda for Migration)| 14. Factors and Impacts of Migration Euro Voc Classification 10 European Union| 2811 migration D Note(s) 1.The Migration Preparedness and Crisis Blueprint aims at developing an early warning and forecasting system at the EU level, which is expected to enable enhanced preparedness, effective governance and timely response to migration situations. 2. The European Commission established the Migration Preparedness and Crisis Blueprint Network, a soft law instrument to support the EU’s emergency and crisis response. The Blueprint is complementary to other EU crisis management mechanisms, such as the EU Civil Protection Mechanism and the Integrated Politi-cal Crisis Response (IPCR) arrangements. It is managed by DG Migration and Home Affairs and serves to monitor, collect, and disseminate vital information to inform subsequent crisis responses. 3. The Migration Preparedness and Crisis Blueprint functions in two stages: ƒ Stage 1: Monitoring and Preparedness: The objective of this stage is to support a more coordinated use of the existing legislation by reinforcing and sharing common situational awareness between all actors involved, developing an early warning/forecasting system at EU level and supporting the development of the necessary resilience in EU Member States to efficiently deal with any type of migration crisis. ƒ Stage 2: Crisis management: The objective of this stage is to support a rapid, efficient and coordinated EU response to a migration crisis by providing timely and up-to-date information to the EU decision-makers on the unfolding operational situation as well as by supporting monitoring, coordination on the ground, and communication at technical level between all actors. 4. Actors involved in the implementation of the two stages are: ƒ EU Member States and their liaison officers, ƒ Council, ƒ European Commission, including the staff posted in the field and in the EU Delega-tions as well as the European Migration Liaison Officers (EMLOs), ƒ European External Action Service including the EU Delegations, relevant Common Security and Defence Policy missions and operations, ƒ EU Agencies (EUAA, Frontex, Europol, eu-LISA and FRA) including their liaison officers. E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 401
migration profile BG миграционен профил CS migrační profil DE Migrationsprofil EL μεταναστευτικό προφίλ / προφίλ μετανάστευσης EN migration profile ES perfil migratorio Definition(s) A tool to bring together and analyse all the relevant information needed to develop policy in the field of migration and development and to monitor the impact of policies implemented. Source(s) FI muuttoprofiili Annex I, 2 (glossary) to the European Commission Communication applying the Global Approach to Migration, COM(2007) 247 final FR profil migratoire Broader term(s) ET rändeprofiil GA próifíl imirce Global Approach to Migration and Mobility (GAMM) HR migracijski profil Related term(s) HU migrációs profil IT profilo migratorio LT migracijos profilis LV migrācijas profils MT Profil migratorju NL migratieprofiel PL profil migracyjny PT perfil migratório RO profil de migraţie SK migračný profil SL migracijski profil SV migrationsprofil NO migrasjonsprofil KA მიგრაციის პროფილი UK міграційний профіль HY 402 միգրացիոն պրոֆիլ Cooperation Platform on Migration and Development Global Forum on Migration and Development (GFMD) mobility partnership EMN Asylum and Migration Classification 15. Migration and Development Euro Voc Classification 2811 migration Note(s) 1. Migration profiles are reports on the migration situation of a country for the purpose of increasing the evidence-base for their own policy development. Such reports contain data and analysis on current migration patterns, labour market trends, remittance flows, information on diasporas and other development-related data. 2. Migration profiles have been produced by IOM and by CARIM (Consortium for Applied Research on International Migration) amongst other organisations. For more information see the description of migration profiles on the IOM website. 3. The Global Forum on Migration and Development also hosts a repository of migration profiles. . 4. Migration profiles entail an analysis of the policy and practice of a state and not that of a person. In this vein, the concept should not be confused with the profiling of a ‘person’. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B migration route BG миграционен път CS migrační trasa DE Migrationsroute EL μεταναστευτική οδός EN migration route ES ruta migratoria ET rändetee FI maahanmuuttoreitti C The geographic route along which migrants and refugees move via hubs in transit areas from their country of origin to their country of destination, often travelling in mixed migration flows. E Source(s) G EMN Asylum and Migration Classification H Derived by EMN from ICMPD FR route migratoire 1. Framework Concepts on Migration (including root causes of migration GA bealach imirce Euro Voc Classification HR migracijska ruta D Definition(s) I 2811 migration J HU migrációs útvonal IT rotta migratoria K LT migracijos maršrutas L LV migrācijas ceļš MT rotta migratorja M NL migratieroute PL szlak migracyjny N PT rota migratória RO rută migratorie / rută de migrație O SK migračná trasa SL migracijska pot P SV migrationsrutt NO reiserute ved migrasjon Q KA მიგრაციის მარშრუტი R UK шлях міграції HY F միգրացիոն ուղի S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 403
migration routes initiative BG Инициатива за миграционни маршрути CS iniciativa migračních tras DE Migrationsrouten-Initiative EL πρωτοβουλία μεταναστευτικών οδών EN migration routes initiative ES iniciativa de rutas migratorias ET rändeteede meede FI muuttoreittejä koskeva aloite FR initiative relative aux routes migratoires GA Tionscnamh um Bhealaí Imirce HR inicijativa na migracijskoj ruti HU migrációs útvonalak kezdeményezés IT Iniziativa Rotte migratorie LT Migracijos maršrutų iniciatyva LV migrācijas ceļu iniciatīva MT Inizzjattiva fir-rigward tar-rotot migratorji NL migratieroutes initiatief PL Inicjatywa ds. Szlaków Migracyjnych PT iniciativa sobre rotas migratórias RO iniţiativa cu privire la rutele de migraţie / inițiativa privind rutele migratorii Definition(s) An initiative by which work along the main migration routes through a particular region and towards the EU is identified and which takes into account the need to work in close collaboration with the third countries along these routes. Source(s) Annex I, 2 (glossary) to the European Commission Communication applying the Global Approach to Migration, COM(2007) 247 final Broader term(s) Global Approach to Migration and Mobility (GAMM) migration route Related term(s) Cooperation Platform on Migration and Development migration profile mobility partnership EMN Asylum and Migration Classification 1. Framework Concepts on Migration (including root causes of migration| 15.1 EU External dimension of migration and mobility Euro Voc Classification 10 European Union| 2811 migration SK iniciatíva migračných trás SL pobuda glede migracijskih poti SV migration routes initiative NO initiativ i tilknytning til migrasjonsruter (b); initiativ i tilknyting til migrasjonsruter (n) KA მიგრაციის მარშრუტების ინიციატივა UK ініціатива зі шляхів міграції HY 404 միգրացիոն ուղիների նախաձեռնություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
Migration, Asylum, Refugees Regional Initiative (MARRI) BG Регионална инициатива по миграция, убежище и бежанци CS Regionální iniciativa pro migraci, azyl a uprchlíky DE Regionale Migrations-, Asyl- und Flüchtlingsinitiative EL Περιφερειακή Πρωτοβουλία για τη Μετανάστευση, το Άσυλο και τους Πρόσφυγες EN Migration, Asylum, Refugees Regional Initiative (MARRI) ES iniciativa regional para la migración, el asilo y los refugiados A B C D Definition(s) An initiative forming part of the South-East European Cooperation Process, which aims to enhance regional cooperation in the field of migration by promoting a comprehensive, integrated, and coherent approach to the issues of migration, asylum, border management, visa policies and consular cooperation, refugee return and settlement in order to meet international and European standards. Source(s) ET rände, varjupaiga ja pagulaste regionaalne algatus FI maahanmuuttoa, turvapaikkaa ja pakolaisia koskeva alueellinen aloite FR initiative régionale en matière de migration, d’asile et de réfugiés J Related term(s) K EMN Asylum and Migration Classification L Euro Voc Classification M MARRI 15.1 EU External dimension of migration and mobility HU Migrációs és Menekültügyi Regionális Kezdeményezés 2811 migration| 7611 European Organisations N Note(s) LV Migrācijas, patvēruma un bēgļu reģionālā iniciatīva NL Regionaal Migratie-, Asiel- en Vluchtelingeninitiatief PL Regionalna Inicjatywa w sprawach Migracji, Azylu i Uchodźstwa PT Iniciativa Regional sobre Migração, Asilo e Refugiados RO Iniţiativa regională cu privire la migraţaie, azil şi refugiaţi 1. MARRI was formed in 2003 within the context of the Stability Pact for South Eastern Europe by merging the Regional Return Initiative (RRI) and the Migration and Asylum Initiative (MAI). Since 2004, MARRI has functioned through two mechanisms: ƒ the MARRI Regional Forum, which provides political and framework support to the Initiative, and ƒ the MARRI Regional Centre in Skopje, which carries out practical cooperation and activities of MARRI and supports the implementation of the decisions reached by the Regional Forum. 2. MARRI’s top priority is the enhancement of regional cooperation in its fields of activities among countries in the region, as a vital part of the EU integration process and in line with the Thessaloniki Agenda for the Western Balkans. 3. For more information, see the website of MARRI. P Q R S U SL Regionalna pobuda za migracije, azil in begunce V SV regionala initiativet för migration, asyl och flyktingar NO regionalt initiativ for asyl og flyktninger for VestBalkan (b); regionalt initiativ for asyl og flyktningar for Vest-Balkan (n) W KA რეგიონული ინიციატივა მიგრაციის, X თავშესაფრისა და ლტოლვილთა საკითხებზე (MARRI) Y UK Регіональна ініціатива з питань міграції, притулку, біженців (MARRI) Z Միգրացիայի, ապաստանի, փախստականների տարածաշրջանային նախաձեռնություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0 O T SK Regionálna iniciatíva pre migráciu, azyl a utečencov (MARRI) HY H Synonym(s) HR Regionalna inicijativa za migracije, azil i izbjeglice (MARRI) MT Inizzjattiva Reġjonali dwar il-Migrazzjoni, l-Ażil, u r-Rifuġjati G I Global Approach to Migration and Mobility (GAMM) LT Migracijos, prieglobsčio ir pabėgėlių regioninė iniciatyva F Website of Migration, Asylum, Refugees Regional Initiative (MARRI) GA Tionscnamh Réigiúnach um Imirce, Tearmann & Dídeanaithe IT Iniziativa Regionale Migrazione, Asilo, Rifugiati E 405
migratory pressure BG миграционен натиск CS migrační tlak DE Migrationsdruck EL μεταναστευτική πίεση EN migratory pressure ES presión migratoria ET rändesurve FI muuttopaine FR pression migratoire GA brú imirce Definition(s) A situation where there is a large number of arrivals of third-country nationals or stateless persons, or a risk of such arrivals, including where this stems from arrivals following search and rescue (SAR) operations, as a result of the geographical location of an EU Member State and the specific developments in third countries which generate migratory movements that place a burden even on well-prepared asylum and reception systems and requires immediate action. Source(s) HR migracijski pritisak Art. 2(w) of the proposed Regulation on Asylum and Migration Management, COM(2020) 610 final HU migrációs nyomás Related term(s) LT migracijos spaudimas migration crisis New Pact on Migration and Asylum LV migrācijas spiediens EMN Asylum and Migration Classification IT pressione migratoria MT Pressjoni migratorja NL migratiedruk PL presja migracyjna PT pressão migratória 2.2 EU (e.g. Common European Asylum System, Qualification Directive, European Agenda for Migration) Euro Voc Classification 10 European Union| 1011 European Union law| 2811 migration RO presiune migratorie SK migračný tlak SL migracijski pritisk SV migrationstryck NO migrasjonspress KA მიგრაციის (ნაკად(ებ)ით გამოწვეული) ზეწოლა UK міграційний тиск HY 406 միգրացիոն ճնշում Note(s) 1. The New Pact on Migration and Asylum was presented together with a set of legislative proposals, including the proposal for an Asylum and Migration Management Regulation. 2. The definition is provisional as the source is the Proposal for the Asylum and Migration Management Regulation. This definition may change in accordance with the further legislative process. It is included in the Glossary because of its importance for further discussions in order to be able to conduct these discussions on a common basis. 3. There is no internationally or universally accepted definition of migratory pressure. Migratory pressure can be seen from the point of view of the country or region of origin but also from the point of view of the destination, transit or host country or region. 4. In the EU context, the terms migration crisis and migratory pressure both refer to situations involving a considerable increase in the numbers of migrants arriving in an EU Member State. However, the situations differ mainly ƒ in the scale (a migration crisis is an “exceptional situation of mass influx; migratory pressure refers to “a large number of arrivals or a risk of such arrivals”) and ƒ in the impact on the EU Member State and its migration authorities (a migration crisis can render the national system “non-functional” and potentially affect the CEAS, whereas migratory pressure places a “burden” on an EU Member State’s system to manage the situation). By all accounts, a migration crisis is a situation of far more gravity than migratory pressure and it can also be caused by instrumentalisation. The classification as a migration crisis or migratory pressure will lead to the application of different legal regimes. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B minimum standards BG минимални стандарти CS minimální normy DE Minimumstandards EL ελάχιστες προδιαγραφές EN minimum standards ES normas mínimas ET miinimumnõuded In an asylum context, a number of principles in relation to procedures for international protection, to reception conditions, and to the refugee definition established by the Treaty of Amsterdam from which EU Member States cannot derogate. Source(s) Derived by EMN from Art. 63 of the Treaty of Amsterdam FR normes minimales Related term(s) GA íoschaighdeáin Common European Asylum System (CEAS) HR minimalni standardi EMN Asylum and Migration Classification LT būtiniausi reikalavimai 4.4 Reception and Accommodation of Applicants for international protection and other refugees| 6.2 Procedure for international protection/Refugee status determination LV minimālie standarti Euro Voc Classification IT norme minime MT Livelli standard minimi D Definition(s) FI vähimmäisvaatimukset HU minimumszabályok C PT normas mínimas RO standarde minime SK minimálne pravidlá / minimálne štandardy G I J K L 1011 European Union law| 2811 migration M Note(s) In the Tampere Agreement, and then reaffirmed by the Hague Programme, EU Member States agreed to go beyond minimum standards and develop a Common European Asylum System (CEAS) based on a common asylum procedure and a uniform status for those who are granted international protection. SL minimalni standardi N O P SV miniminormer NO minimumsstandard Q KA მინიმალური სტანდარტები R UK мінімальні стандарти HY F H NL minimumnormen PL minimalne standardy E նվազագույն չափանիշներ S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 407
minor BG непълнолетно лице CS nezletilý DE Minderjähriger EL ανήλικος EN minor ES menor ET alaealine FI alaikäinen FR mineur GA mionaoiseach HR maloljetnik HU kiskorú Definition(s) In a legal context and in contrast to a child, a person who, according to the law of their respective country, is under the age of majority, i.e. is not yet entitled to exercise specific civil and political rights. Source(s) UNHCR International Thesaurus of Refugee Terminology Related term(s) adult age assessment child EMN Asylum and Migration Classification IT minore/minorenne 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) LT nepilnametis Euro Voc Classification LV nepilngadīgais MT Minorenni NL minderjarige PL małoletni PT menor RO minor SK maloletý SL mladoletnik SV underårig 2816 demography and population Note(s) 1. This is the preferred term to use when referring to an individual. The term ‘child’ should then be used to describe the relationship with other family members. 2. The age specified by law, called the ‘legal age of majority’, indicates that a person acquires full legal capacity to be bound by various documents, such as contracts and deeds, that they make with others and to commit other legal acts such as voting in elections and entering marriage. The age at which a person becomes an adult varies from State to State and often varies within a State, depending upon the nature of the action taken by the person. NO mindreårig KA არასრულწლოვანი UK неповнолітній HY 408 անչափահաս EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B minority BG малцинство CS menšina C ES minoría A non-dominant group which is usually numerically less than the majority population of a State or region regarding their ethnic, religious or linguistic characteristics and who (if only implicitly) maintain solidarity with their own culture, traditions, religion or language. ET vähemus Source(s) DE Minderheit EL μειονότητα EN minority D Definition(s) E F G FI vähemmistö Derived by EMN from IOM Glossary on Migration, 2019. FR minorité Narrower term(s) HR manjina ethnic minority national minority HU kissebbség Related term(s) GA mionlach IT minoranza LT mažuma LV minoritāte MT Minoranza / F’minoranza NL minderheid PL mniejszość PT minoria RO minoritate SK menšina I J ethnic nationality K EMN Asylum and Migration Classification 1. Framework Concepts on Migration (including root causes of migration| 14.1 Political factors and impacts (such as political stability, political climate, public discourse, partly overlap with class 2)| 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) Euro Voc Classification NO minoritet KA უმცირესობა UK меншина HY փոքրամասնություն L M N O 04 Politics| 1236 rights and freedoms| 28 Social Questions SL manjšina SV minoritet H P Note(s) 1. There is still no universally accepted definition of minority in international law, although a variety of international documents have attempted to define the concept of a minority. See, for example, Art. 27 of the 1966 International Covenant on Civil and Political Rights (ICCPR) . 2. This definition has been added because of its relevance to international protection and integration-related aspects. Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 409
mixed migration flow BG смесен миграционен поток CS smíšený migrační tok DE gemischte Wanderungsbewegung / gemischte Migrationsbewegung EL μεικτές μεταναστευτικές ροές EN mixed migration flow ES flujo migratorio mixto ET segarändevoog (no usual translation) FI erilaisista ryhmistä koostuva muuttovirta FR flux migratoire mixte GA sreabhadh imirce measctha Definition(s) Complex migratory population movement including refugees, asylum seekers, economic migrants and other types of migrants as opposed to migratory population movements that consist entirely of one category of migrants. Source(s) Developed by EMN Related term(s) migration flow EMN Asylum and Migration Classification HR mješani migracijski tok 1. Framework Concepts on Migration (including root causes of migration HU vegyes migrációs áramlás Euro Voc Classification IT flusso migratorio misto 2811 migration LT mišrūs migracijos srautai LV jauktas migrācijas plūsma MT Fluss migratorju mħallat / Nixxiegħa migratorja mħallta NL gemengde migratiestroom Note(s) 1. The International Organization for Migration (IOM) uses the term mixed movements (mixed migration or mixed flows) with the following definition: A movement in which a number of people are travelling together, generally in an irregular manner, using the same routes and means of transport, but for different reasons. PL mieszane przepływy migracyjne PT fluxo migratório misto RO flux de migraţie mixtă SK zmiešané migračné toky SL mešani migracijski tok SV blandade migrationsströmmar NO blandet migrasjonsstrøm (b); blanda migrasjonsstraum (n) KA შერეული მიგრაციული ნაკადი UK змішаний міграційний потік HY 410 միգրացիայի խառը հոսքեր EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B mobility partnership BG Партньорство за мобилност CS partnerství pro mobilitu EL σύμπραξη κινητικότητας EN mobility partnership ES asociación de movilidad ET rändepartnerlus FI liikkuvuuskumppanuus A cooperation arrangement, on the basis of political declarations, that provides the bilateral framework for dialogue and practical cooperation to address relevant migration and mobility issues of mutual concern primarily with EU neighbourhood countries, including short and long-term mobility, on a voluntary basis. E Source(s) H Council Conclusions (No 42) on the Global Approach of Migration and Mobility of 29 May 2012 FR partenariat pour la mobilité GA comhpháirtíocht soghluaisteachta Synonym(s) HR partnerstvo za mobilnost Related term(s) IT partenariato per la mobilità NL mobiliteitspartnerschap circular migration Cooperation Platform on Migration and Development Global Approach to Migration and Mobility (GAMM) migration profile readmission agreement PL Partnerstwo na rzecz Mobilności EMN Asylum and Migration Classification LT judumo partnerystė LV mobilitātes partnerība MT Sħubija għall-mobbilita’ PT parcerias para a mobilidade 15.1 EU External dimension of migration and mobility RO parteneriat pentru mobilitate Euro Voc Classification SK partnerstvo v oblasti mobility / mobilitné partnerstvo NO mobilitetspartnerskap (b); mobilitetspartnarskap (n) KA პარტნიორობა მობილობისთვის UK партнерство з мобільності HY շարժունակության շուրջ համագործակցություն F G I J MP HU mobilitási partnerség SV partnerskap för rörlighet D Definition(s) DE Mobilitätspartnerschaft SL partnerstvo za mobilnost C K L M N 10 European Union| 2811 migration O Note(s) P 1. Mobility partnerships (MPs) are an important tool of the EU’s Global Approach to Migration and Mobility (GAMM), providing the overall framework for managing various forms of legal movement between the EU and third countries. Such partnerships are agreed with those third countries that have in place effective mechanisms for readmission of irregular migrants. 2. For further information on the Global Approach to Migration and Mobility and on mobility partnerships, see the website of DG HOME. Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 411
multiculturalism BG мултикултурализъм CS multikulturalismus Definition(s) ES multiculturalismo A policy that endorses the principle of cultural diversity and supports the right of different cultural and ethnic groups to retain distinctive cultural identities ensuring their equitable access to society, encompassing constitutional principles and commonly shared values prevailing in the society. ET multikultuursus Source(s) DE Multikulturalismus EL πολυπολιτισμικότητα EN multiculturalism FI monikulttuurisuus FR multiculturalisme GA ilchultúrthacht HR multikulturalizam HU multikulturalizmus IT multiculturalismo LT multikultūriškumas LV multikulturālisms MT Multikulturaliżmu NL multiculturalisme PL wielokulturowość PT multiculturalismo RO multiculturalism SK multikulturalizmus SL multikulturalizem SV multikulturalism NO multikulturalisme KA კულტურული მრავალფეროვნების დაცვის პოლიტიკა/მულტიკულტურალიზმი UK мультикультуралізм HY 412 բազմամշակութայնություն Derived by EMN from the FRA (EUMC) Open Glossary (no longer available online) Synonym(s) interculturalism Related term(s) cultural diversity EMN Asylum and Migration Classification 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) Euro Voc Classification 2811 migration Note(s) 1. The term was first used in 1957 to describe CH, but came into common currency in Canada in the late 1960s. It quickly spread to other English-speaking countries. 2. There is no universally accepted definition of multiculturalism, multiculturalism can refer to different concepts: demographic facts, philosophical or political ideas and values. 3. Multiculturalism emphasises cultural differences and different cultures existing next to each other without necessarily much contact or participative interaction. 4. The model of multiculturalism has often been criticised on different grounds. Critics of multiculturalism question the ideal of the maintenance of distinct ethnic cultures within a state; others argue that policies of multiculturalism have failed to create inclusion of different cultures within society, but instead have divided society by legitimising segregated separate communities that have isolated themselves and accentuated their specificity. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B mutual information mechanism BG Механизъм за взаимно информиране CS mechanismus vzájemné výměny informací E A mechanism for the mutual exchange of information concerning national measures in the areas of asylum and immigration that are likely to have a significant impact on several EU Member States or on the European Union as a whole. EL μηχανισμός αμοιβαίας πληροφόρησης EN mutual information mechanism ES Mecanismo de Información Mutua F G Source(s) ET vastastikune teabesüsteem FI keskinäinen tiedottamisjärjestelmä Art. 1 of Council Decision 2006/688/EC (Mutual Information Mechanism Decision) FR mécanisme d’information mutuelle Synonym(s) H MIM mutual information mechanism concerning Member States’ measures in the area of asylum and immigration GA Sásra um Fhaisnéis Fhrithpháirteach HR Zajednički mehanizam informiranja HU kölcsönös tájékoztatási mechanizmus Related term(s) IT Meccanismo di Informazione Reciproca LV savstarpējās informācijas apmaiņas mehānisms NL wederzijdse Informatiemechanisme PL Mechanizm Wymiany Informacji PT mecanismo de informação mútua RO mecanismul de informare mutuală / mecanismul de informare reciprocă 14.1 Political factors and impacts (such as political stability, political climate, public discourse, partly overlap with class 2) M Euro Voc Classification N 10 European Union| 2811 migration O Note(s) The mechanism also allows for the preparation of exchanges of views and debates on such measures. SV system för ömsesidigt informationsutbyte P Q NO Ordning for gjensidig informasjonsutveksling KA ინფორმაციის ურთიერთგაცვლის მექანიზმი R UK механізм взаємообміну інформацією HY J L EMN Asylum and Migration Classification MT Mekkaniżmu għal Informazzjoni Reċiproka I K Information and Coordination Network for Member States’ Migration Management Services (ICONet) LT Tarpusavio keitimosi informacija mechanizmas SL mehanizem vzajemnega obveščanja D Definition(s) DE Mechanismus zur gegenseitigen Information SK mechanizmus vzájomnej výmeny informácií C S փոխադարձ տեղեկատվական մեխանիզմ T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 413
mutual recognition agreement BG споразумение за взаимно признаване CS smlouva o vzájemném uznávání rovnocennosti dokladů o vzdělání DE gegenseitige Anerkennungsvereinbarung EL συμφωνία αμοιβαίας αναγνώρισης EN mutual recognition agreement ES acuerdo de reconocimiento mutuo ET vastastikuse tunnustamise leping FI sopimus vastavuoroisesta tunnustamisesta FR accord de reconnaissance mutuelle GA comhaontú maidir le haitheantas frithpháirteach HR sporazum o uzajamnom priznavanju HU kölcsönös elismerési megállapodás IT accordo di reciproco riconoscimento LT susitarimas dėl abipusio pripažinimo LV savstarpējas atzīšanas līgums MT Ftehim għar-rikonoxximent reċiproku Definition(s) Agreements on the recognition of foreign qualifications negotiated by governments and professional organisations in several countries by setting out clear rules for licensing or certifying migrant professionals who move between signatory countries in order to reduce, or even eliminate, the need for case-by-case assessments when applicants have been trained in systems conferring essentially comparable skills and knowledge. Source(s) Migration Policy Institute: Skilled Immigrants in the Global Economy: Prospects for International Cooperation on Recognition of Foreign Qualifications, 2013 Synonym(s) MRA Related term(s) highly qualified migrant EMN Asylum and Migration Classification PT acordo de reconhecimento mútuo 8.2 Access to employment| 14.2 Economic factors and impacts (such as brain drain/gain, employment/ unemployment, labour market, economic growth, dumping)| 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) RO acord de recunoaştere mutuală Euro Voc Classification NL overeenkomst inzake wederzijdse erkenning PL umowa o wzajemnym uznaniu kwalifikacji SK dohoda o vzájomnom uznávaní rovnocennosti dokladov o vzdelaní SL sporazum o vzajemnem priznavanju SV avtal om ömsesidigt erkännande av kvalifikationer NO avtale om gjensidig godkjenning KA ურთიერთაღიარების შეთანხმება UK договір про взаємне визнання HY 414 փոխադարձ ճանաչման համաձայնագիր 3206 education Note(s) 1. MRAs can lessen barriers migrant professionals face when transferring their skills and experience across borders and help governments to recognise professional qualifications from other jurisdictions. They come in several different forms with major variations in the scope of the agreement and the benefits they provide to the applicant (automatic, partial or limited-scope recognition, temporary access). 2. The furthest-reaching and most comprehensive system is the EU’s system outlined in Council Directive 2005/36/EC (Professional Qualification Directive) which covers all regulated occupations in all EU Member States and reduces regulatory authorities’ discretion to reject applicants that fall under its purview. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
National Contact Points on Integration BG Национални точки за контакт по интеграция CS národní kontaktní body pro integraci EL Εθνικά Σημεία Επαφής για την Ένταξη EN National Contact Points on Integration ES puntos de contacto nacional de integración ET integratsiooni riiklikud kontaktpunktid FI Kotouttamisasioiden kansalliset yhteyspisteet FR Points de contact nationaux en matière d’intégration GA Pointí Teagmhála Náisiúnta le haghaidh Imeascadh HU integrációs nemzeti kapcsolattartó pontok IT Punti di contatto nazionali sull’integrazione LT Nacionalinis integracijos informacijos centras LV nacionālie integrācijas kontaktpunkti MT Punti ta’ Kuntatt Nazzjonali fuq l-Integrazzjoni NL nationale contactpunten voor integratie PL Krajowe punkty kontaktowe ds. Integracji PT Pontos de Contacto Nacionais de Integração RO punctele naţionale de contact pentru integrare SK národné kontaktné body pre integráciu SL Nacionalne kontaktne točke za integracijo SV nationella kontaktpunkter på integrationsområdet NO nasjonale kontaktpunkter på integreringsfeltet (b); nasjonale kontaktpunkt på integreringsfeltet (n) KA ეროვნული საკონტაქტო პირები ინტეგრაციის საკითხებში UK Національні контактні пункти з інтеграції HY Ինտեգրման ազգային կոնտակտային անձիք B C D Definition(s) DE Nationale Kontaktstellen für Integration HR nacionalne kontaktne točke za integraciju A A network of authorities responsible for integration issues which serves to facilitate exchange of information and good practice at EU level with the purpose of finding successful solutions for the integration of immigrants in all EU Member States and to ensure policy coordination and coherence at national level and with EU initiatives. E Source(s) H Synonym(s) I Broader term(s) J European Website on Integration NCPI integration F G K Narrower term(s) Handbook on Integration L Related term(s) Common Basic Principles European Migration Network (EMN) M EMN Asylum and Migration Classification N Euro Voc Classification O 9. Integration 28 Social Questions| 2811 migration P Note(s) 1. The network was created by the European Commission following the conclusions of the Council of Justice and Home Affairs (JAI) of October 2002. 2. The National Contact Points on Integration consider inter alia employment, education, language, health, housing, culture and participation. The network›s long-term objective is to develop and reinforce the European framework for integration, in order to define Common Basic Principles and objectives, to determine assessment measures, and to reinforce the coordination of national and European integration policies. 3. One output which the National Contact Points on Integration are very much involved in are the Handbooks on Integration. For more information, see the European Website on Integration. Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 415
national referral mechanism BG национален механизъм за насочване CS národní referenční mechanismus Definition(s) EL εθνικός μηχανισμός παραπομπής (NRM) (EL); εθνικός μηχανισμός αναφοράς (CY) Mechanism aimed at identifying, protecting and assisting victims of trafficking in human beings, through referral, and involving relevant public authorities and civil society. EN national referral mechanism Source(s) DE nationaler Überweisungsmechanismus ES Mecanismo nacional de derivación ET nõustamisele suunamise riiklik mehhanism FI kansallinen ihmiskaupan uhrien tunnistamis- ja ohjausjärjestelmä (NRM) FR mécanisme national d’orientation Derived by EMN from the EU Commission: Communication: the EU Strategy towards the Eradication of Trafficking in Human Beings 2012-2016, COM(2012)286 final Synonym(s) GA meicníocht náisiúnta atreorúcháin national cooperation mechanism NRM HR nacionalni referalni mehanizam Related term(s) HU nemzeti áldozatkezelési mechanizmus IT meccanismo nazionale di riferimento national rapporteur or equivalent mechanism trafficking in human beings LT nacionalinis nukreipimo mechanizmas EMN Asylum and Migration Classification LV nacionālais novirzīšanas mehānisms 13.2 Trafficking in human beings MT Mekkaniżmu nazzjonali għal riferiment / ta’ referenza Euro Voc Classification NL nationaal verwijsmechanisme PL krajowy mechanizm referencyjny PT mecanismo de referência nacional RO mecanism naţional de sesizare SK národný referenčný mechanizmus SL nacionalni mehanizem za napotitev SV nationell hänskjutningsmekanism NO nasjonal henvisningsordning (b); nasjonal tilvisingsordning (n) KA რეფერირების ეროვნული მექანიზმი UK національний механізм направлення HY 416 ուղղորդման ազգային մեխանիզմ 12 Law Note(s) 1. This definition was derived for the purpose of EMN-study: Identification of victims of trafficking in human beings in international protection and forced return procedures 2014 with the support of the Office of the Anti-Trafficking Coordinator. 2. The Organisation for Security and Cooperation in Europe (OSCE) defines an NRM as a cooperative framework at national level by which state actors coordinate their efforts in a strategic partnership with civil society to identify, protect and assist victims of trafficking in human beings to ensure that the human rights of trafficked persons are respected and to provide an effective way to refer victims of trafficking to services. For more OSCE: National referral mechanism: joining efforts to protect the rights of trafficked persons, 2004. . The National Rapporteurs or Equivalent Mechanisms (NREMs) are responsible for monitoring the implementation of anti-trafficking policy at the national level and play a key role in data collection on trafficking in human beings at national and EU level. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B naturalisation BG натурализация CS nabytí občanství / naturalizace DE Einbürgerung EL πολιτογράφηση EN naturalisation ES adquisición de nacionalidad C D Definition(s) Any mode of acquisition after birth of a nationality not previously held by the target person that requires an application by this person or their legal agent as well as an act of granting nationality by a public authority. E Source(s) G ET naturalisatsioon Global Citizenship Observatory (GLOBALCIT): Glossary on Citizenship and Electoral Rights FI kansalaistaminen Broader term(s) FR naturalisation GA eadóirsiú; eadóirseacht HR prirođenje acquisition of citizenship IT naturalizzazione LV naturalizācija MT Naturalizzazzjoni 12 Law J Note(s) K This definition does not include automatic acquisition that is not initiated by the individual concerned or their legal agent (even in cases where the individual has an option to decline this attribution of nationality) or acquisition of nationality based on a unilateral act by the target person (e.g. acquisition by declaration or option). L M NL naturalisatie; nationaliteitsverklaring (BE) PL naturalizacja N PT naturalização RO obţinerea cetăţeniei / naturalizare O SK naturalizácia SL naturalizacija P SV naturalisation NO naturalisering Q KA ნატურალიზაცია R UK натуралізація HY H I Euro Voc Classification HU honosítás LT natūralizacija F հպատակագրում S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 417
net migration BG нетна миграция CS saldo migrace Definition(s) DE Nettomigration The difference between immigration into and emigration from a given area during the year. EL καθαρή μετανάστευση Source(s) EN net migration Eurostat’s Concepts and Definitions Database ES saldo migratorio Related term(s) ET rändesaldo FI nettomaahanmuutto FR solde migratoire GA imirce ghlan HR migracijski saldo HU nettó migráció IT migrazione netta (o saldo migratorio) LT neto migracija LV migrācijas saldo MT Migrazzjoni netta NL migratiesaldo / netto migratie PL migracja netto PT saldo migratório crude rate of net migration migration flow population stock total migration Euro Voc Classification 2811 migration Note(s) 1. Net migration is negative when the number of emigrants exceeds the number of immigrants. 2. Since many countries either do not have accurate figures on immigration and emigration or have no figures at all, net migration is frequently estimated as the difference between total population change and natural increase between two dates (in Eurostat’s database it is then called corrected net migration). The statistics on net migration are therefore affected by any statistical inaccuracies in any of the components used for their derivation. RO migraţia netă SK migračné saldo / čistá migrácia SL neto migracije / migracijski saldo SV nettomigration NO netto migrasjon KA მიგრაციის სალდო UK чиста міграція HY 418 զուտ միգրացիա EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B New Pact on Migration and Asylum BG Нов пакт за миграцията и убежището CS Nový pakt o migraci a azylu DE neues Migrations- und Asylpaket (EU acquis); neuer Migrations- und Asylpakt EL Νέο Σύμφωνο για τη Μετανάστευση και το Άσυλο EN New Pact on Migration and Asylum ES Nuevo Pacto sobre Migración y Asilo ET uus rände- ja varjupaigalepe FI Uusi muuttoliike- ja turvapaikkasopimus FR nouveau pacte sur la migration et l’asile GA An Comhaontúfir Nua Imirce agus Tearmainn HR Novi pakt o migracijama i azilu HU új Migrációs és Menekültügyi Paktum IT Nuovo Patto sulla Migrazione e l’Asilo C D Definition(s) Common European framework for migration and asylum management bringing together policy in the areas of migration, asylum, integration and border management. E Source(s) G F European Commission: Communication on a New Pact on Migration and Asylum, COM(2020) 609 final Broader term(s) asylum migration I Related term(s) J EMN Asylum and Migration Classification K European Agenda on Migration LT Naujas migracijos ir prieglobsčio paktas 2.2 EU (e.g. Common European Asylum System, Qualification Directive, European Agenda for Migration) LV jauns Migrācijas un patvēruma pakts Euro Voc Classification MT Patt Ġdid dwar il-Migrazzjoni u l-Ażil NL PL Nowy Pakt ws. Migracji i Azylu PT Novo Pacto em matéria de Migração e Asilo RO Noul pact privind migrația și azilul SK Nový pakt o migrácii a azyle SL novi pakt o migracijah in azilu SV ny migrations- och asylpakt NO Ny pakt for migrasjon og asyl (Pakten) KA ახალი პაქტი მიგრაციისა და თავშესაფრის შესახებ UK Новий пакт про міграцію та притулок HY Միգրացիայի և ապաստանի մասին նոր պայմանագիր H 04 Politics| 10 European Union| 1011 European Union law| 2811 migration L M N Note(s) 1. The Pact sets out a new framework that ensures that the principle of solidarity and fair sharing of responsibility is effectively respected by all EU Member States in cases where national asylum systems of one or more EU Member States are not able to cope with an emergency situation characterised by a sudden influx of third-country nationals and guarantee a well-functioning EU migration management system. 2. It aims at: ƒ robust and fair management of external borders, including identity, health and security checks; ƒ fair and efficient asylum rules, streamlining procedures on asylum and return; ƒ a new solidarity mechanism for situations of search and rescue, pressure and crisis; ƒ stronger foresight, crisis preparedness and response; ƒ an effective return policy and an EU-coordinated approach to returns; ƒ comprehensive governance at EU level for better management and implementation of asylum and migration policies; ƒ mutually beneficial partnerships with key third countries of origin and transit; ƒ developing sustainable legal pathways for those in need of protection and to attract talent to the EU; and supporting effective integration policies. O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 419
New York Declaration for Refugees and Migrants BG Нюйоркска декларация за бежанци и мигранти CS Newyorská deklarace o uprchlících a migrantech DE New Yorker Erklärung für Flüchtlinge und Migranten / New Yorker Erklärung zu Flüchtlingen und Migranten EL Διακήρυξη της Νέας Υόρκης για τους πρόσφυγες και τους μετανάστες EN New York Declaration for Refugees and Migrants ES Declaración de Nueva York para los Refugiados y los Migrantes ET pagulasi ja rändajaid käsitlev New Yorgi deklaratsioon FI New Yorkin julkilausuma pakolaisten ja siirtolaisten oikeuksien suojelemiseksi FR Déclaration de New York pour les réfugiés et les migrants GA Dearbhú Nua-Eabhrac maidir le Dídeanaithe agus Imircigh HR Njujorška deklaracija za izbjeglice i migrante HU a menekültekről és a migránsokról szóló New York-i nyilatkozat IT Dichiarazione di New York sui rifugiati e i migranti LT Niujorko deklaracija dėl pabėgėlių ir migrantų LV Ņujorkas deklarācija par bēgļiem un migrantiem MT Dikjarazzjoni(Id-) ta’ New York dwar ir-Refuġjati u l-Migranti NL Verklaring van New York voor Vluchtelingen en Migranten PL Deklaracja Nowojorska dotyczącą Uchodźców i Migrantów Definition(s) United Nations General Assembly Declaration comprising a set of commitments to enhance the protection of refugees and migrants. Source(s) Derived by EMN from the description of the New York Declaration for Refugees and Migrants on the UNWebsite and on the UNHCR-Website Narrower term(s) Global Compact for Safe, Orderly and Regular Migration Global Compact on Refugees Euro Voc Classification 04 Politics| 2811 migration Note(s) 1. The New York Declaration for Migrants and Refugees adopted on 19 September 2016 is the first UN declaration on migration adopted at this level. It acknowledges that migration and refugee matters have become major issues in the international agenda, that there is a pressing need for a comprehensive approach to human mobility and that protection of refugees is a shared international responsibility which requires and enhanced global cooperation on migration. 2. The Declaration reaffirms the importance of the international protection regime (the Geneva Refugee Convention and Protocol) and the obligations to fully respect the human rights of refugees and migrants. 3. It sets out the core elements of a Comprehensive Refugee Response Framework to be applied to large-scale movements of refugees and protracted refugee situations. 4. The Declaration calls upon the United Nations High Commissioner for Refugees (UNHCR) to propose a global compact on Refugees and also provides for the negotiation of a global compact for safe, orderly and regular migration. 5. For more information see the description of the New York Declaration for Refugees and Migrants on the Website of UNHCR: PT Declaração de Nova Iorque sobre os refugiados e os migrantes RO Declarația de la New York pentru refugiați și migranți SK Newyorská deklarácia pre utečencov a migrantov SL Newyorška deklaracija o beguncih in migrantih SV New York-deklarationen om flyktingar och migranter NO New York erklæringen om flyktninger og migranter (b); New York utsegnet om flyktningar og migrantar (n) KA ნიუ-იორკის დეკლარაცია ლტოლვილებისა და მიგრანტების შესახებ UK Нью-Йоркська декларація про біженців та мігрантів HY 420 Փախստականների և միգրանտների մասին Նյու Յորքի հռչակագիր EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B non-EU national C BG гражданин на трета страна CS osoba, která není občanem EU / státní příslušník třetí země DE Nicht-EU-Bürger Any person not having the nationality of an EU Member State. E Source(s) F EL πολίτης χώρας που δεν ανήκει στην Ε.Ε (EL); υπήκοος χώρας που δεν ανήκει στην Ε.Ε (CY) Derived by EMN from Art. 20(1) of Treaty on the Functioning of the European Union (TFEU) EN non-EU national Narrower term(s) ES nacional de tercer país D Definition(s) G H third-country national ET Mitte-EL kodanik Related term(s) FR non-ressortissant d’un État membre alien union citizen I GA náisiúnach neamh-AE Euro Voc Classification J FI EU:hun kuulumattoman valtion kansalainen HR osoba koja nema državljanstvo države članice EU-a HU nem EU-s állampolgár 1011 European Union law K Note(s) IT cittadino non comunitario This means that nationals of NO, IS, LI and CH are non-EU nationals, but they are not third-country nationals, as defined, primarily because they have the right to free movement. LT ne ES pilietis LV persona bez ES pilsonības MT Ċittadin(a) ta’ pajjiż barra l-UE / mhux fl-UE NL derdelander / niet-EU onderdaan L M N PL obywatel państwa trzeciego O PT nacional de país terceiro RO cetățean din afara UE / resortisant al unei țări terțe SK štátny príslušník tretej krajiny / osoba, ktorá nie je občanom EÚ P SL nedržavljan EU Q SV icke-EU-medborgare / tredjelandsmedborgare NO borger av et land som ikke er medlem i EU (b); borgar av eit land som ikkje er medlem i EU (n) R KA ევროკავშირის არამოქალაქე პირი S UK негромадянин ЄС HY T Ոչ Եվրոպական Միության անդամ պետության քաղաքացի U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 421
non-refoulement BG non-refoulement / забрана за експулсиране или връщане CS princip nenavracení / non-refoulement DE Nichtzurückweisung / Non-refoulement / Schutz vor Zurückweisung / Verbot der Ausweisung und Zurückweisung EL μη- επαναπροώθηση EN non-refoulement ES non-refoulement ET tagasisaatmise lubamatus / non-refoulement FI palauttamiskielto FR non-refoulement; interdiction de retour forcé (LU) GA neamh-refoulement HR zabrana prisilnog udaljenja ili vraćanja Definition(s) In the global context, a core principle of international refugee and human rights law that prohibits States from returning individuals to a country where there is a real risk of being subjected to persecution, torture, inhuman or degrading treatment or punishment or any other human rights violation. In the refugee context, a core principle of international refugee law that prohibits States from returning refugees in any manner whatsoever to countries or territories in which their lives or freedom may be threatened on account of their race, religion, nationality, membership of a particular social group or political opinion. Source(s) IT non-refoulement Global context: developed by EMN Refugee context: Art. 33 of the Geneva Refugee Convention and Protocol LT negrąžinimas Related term(s) HU visszaküldés tilalma LV neizraidīšana MT Prinċipju (il-) ta’ non-refoulement - li ma jsirx ritorn imġiegħel jew sfurzat forced return removal EMN Asylum and Migration Classification NL non-refoulement / beginsel van niet-uitwijzing 4.1.1 Refugee protection PL zasada non-refoulement/ zasada niewydalania Euro Voc Classification PT non-refoulement RO non-refoulment / principiul nereturnării SK zásada zákazu vyhostenia alebo vrátenia / zásada non-refoulement / princíp nenavrátenia SL načelo nevračanja SV non-refoulement (förbud mot avvisning / utvisning) NO vern mot utsendelse (b); vern mot utsending (n) KA არგაძევება UK неприпустимість вислання HY 422 չվերադարձելիություն 1231 international law| 2811 migration Note(s) 1.The principle of non-refoulement is a part of customary international law and is therefore binding on all States, whether or not they are parties to the Geneva Refugee Convention and Protocol. 2. In international law the prohibition on refoulement has been developed in various legal instruments, on both a global and a regional level, such as in Art. 3 of the Convention against Torture (CAT), in Art.7 of the International Covenant on Civil and Political Rights (ICCPR) and Art. 3 of the European Convention on Human Rights (ECHR). Initially, the prohibition on refoulement was developed in relation to the protection of refugees. 3. The ECHR does not contain an explicit prohibition on refoulement. However, in particular, under Art. 3 of ECHR a refoulement prohibition has been developed by the case law of the European Court of Human Rights (ECtHR). 4. Art. 3 of the ECHR also prohibits indirect refoulement, the removal to a third - intermediary - country from which the individual may then be removed to the country in which he faces a real risk of the proscribed ill-treatment. 5.For further information see: Wouters, Cornelius Wolfram: International legal Standards for the Protection from Refoulement. - Leiden, 2009 . EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B non-removable returnee BG лице, подлежащо на връщане, за което връщането не може да бъде осъществено C D Definition(s) CS osoba, u které nelze realizovat návrat DE Rückkehrpflichtige Person, die nicht zurückgeführt werden kann; nicht rückführbarer Rückkehrer (EU-Acquis) EL πολίτης τρίτης χώρας ανεφίκτου απελάσεως Third country national who has no legal right to stay in the territory of one of the EU Member States and who is subject to a return decision but who can nevertheless not be immediately returned for various reasons. E Source(s) G Derived by EMN from the EU Commission: Communication on the EU Return Policy, COM(2014) 199 final EN non-removable returnee ES persona con orden de expulsión que no puede ser materializada F H Synonym(s) I FR personne non-éloignable; personne inéloignable (BE) non-deportable non-removable irregular migrant undesirable and non-removable migrant GA fillí neamh-inaistrithe Related term(s) K Euro Voc Classification L ET tagasipöörduja, keda ei saa välja saata FI palautettava henkilö, jota ei voida poistaa maasta J postponement of removal HR povratnik kojeg se ne može udaljiti HU nem kitoloncolható visszatérő 2811 migration IT Rimpatriandi non allontanabili LT užsienietis, kurio negalima grąžinti M Note(s) LV neizraidāma persona MT Migrant(a) ritornat(a) li ma tistax tintbagħat lura NL niet-verwijderbare terugkeerder / niet-uitzetbare terugkeerder PL cudzoziemiec, którego decyzja o powrocie jest niewykonywalna PT cidadão estrangeiro inexpulsável / repatriado inexpulsável RO repatriat care nu poate fi îndepărtat SK nenavrátiteľný cudzinec SL oseba v postopku vračanja, ki je ni mogoče odstraniti SV återvändande som ej kan avlägsnas ur landet NO person med utreiseplikt som ikke kan returneres (b); person med utreiseplikt som ikkje kan returnerast (n) 1. Barriers to removal may be legal, humanitarian or practical in nature or they may result from policy choices. Barriers to return are discussed in the EMN Focussed Study: Returning Rejected Asylum Seekers: challenges and good practices, 2016. . 2. According to section 13.2 of the ‘Return Handbook’ EU Member States have no obligation to grant a residence permit to non-removable returnees once it becomes clear that there is no more reasonable prospect of removal, but EU Member States are free to do so at any moment. 3. Non-removables include “undesirable and non-removable migrants” who are excluded on the basis of Art. 1F of the Geneva Refugee Convention and Protocol and who may not be refouled because of human rights obligations. 4. Penal sanctions aimed at dissuading non-removable returnees who have no justified reasons for non-return from remaining illegally must comply with fundamental rights, particularly those guaranteed by the European Convention on Human Rights (ECHR) and the Charter of Fundamental Rights of the European Union (CFR), and must comply with the proportionality principle. The maximum time for depriving the liberty of non-cooperating returnees is limited by Directive 2008/115/EC (Return Directive) to 18 months. See the ‘Return Handbook’ for more information. KA პირი, რომლის გაძევება დაუშვებელია/ O P Q R S T U შეუძლებელია UK особа, яка підлягає поверненню, яка не може бути повернена HY N V վերադարձի ենթակա անձ, ով չի վերադարձվում որոշակի պատճառներով W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 423
nuclear family BG семейно ядро CS nukleární rodina / rodina v užším slova smyslu DE Kernfamilie EL πυρηνική οικογένεια Definition(s) The spouse and the minor children of a family. Source(s) EN nuclear family Recital 9 of Council Directive 2003/86/EC (Family Reunification Directive) ES familia nuclear Related term(s) ET tuumikperekond FI ydinperhe FR famille nucléaire GA teaghlach núicléach HR uža obitelj HU családmag / szűkebb család IT famiglia nucleare LT branduolinė šeima LV nukleārā ģimene MT Familja nukleari family formation family member family reunification EMN Asylum and Migration Classification 3.2 Migration for Family Reasons Euro Voc Classification 2806 family| 2811 migration Note(s) This definition refers specifically to the context of family reunification only. NL kerngezin PL rodzina nuklearna PT núcleo familiar RO familie nucleară SK užšia rodina SL jedrna družina SV kärnfamilj NO kjernefamilie KA ნუკლეარული ოჯახი UK основна сім’я HY 424 միջուկային ընտանիք EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B obligation to cooperate BG задължение за сътрудничество C D Definition(s) CS povinnost spolupracovat Obligation imposed by EU Member States upon the applicant for international protection to cooperate with the competent authorities insofar as such obligations are necessary for the processing of the application. DE Mitwirkungspflicht EL υποχρεώση συνεργασίας EN obligation to cooperate ES Obligación de cooperar Source(s) ET koostöökohustus Derived by EMN from Art. 4(1) of Directive 2011/95/EU (Recast Qualification Directive) and Art. 13 of Directive 2013/32/EU (Recast Asylum Procedures Directive) FI yhteistyövelvoite FR obligation de coopérer GA dualgas comhoibrithe Synonym(s) HR obaveza suradnje EMN Asylum and Migration Classification IT obbligo di collaborazione 6.2 Procedure for international protection/Refugee status determination LT pareiga bendradarbiauti LV pienākums sadarboties Euro Voc Classification MT Obbligu ta’ kooperazzjoni 1011 European Union law| 2811 migration PT obrigação de cooperar RO obligația de a coopera SK povinnosť spolupracovať SL obveznost sodelovanja SV skyldighet att samarbeta NO plikt til å samarbeide KA თანამშრომლობის ვალდებულება UK зобов’язання зі співробітництва HY G H I K L M NL verplichting tot samenwerking / medewerkingsplicht PL obowiązek współpracy F J duty to cooperate HU együttműködési kötelezettség E Note(s) 1. These may include obligations of applicants to: (a) report to the competent authorities or to appear before them in person; (b) to hand over documents in their possession relevant to the examination of the application, such as their passports; (c) to inform the competent authorities of their current place or address; (d) to be personally searched and the items they carry with them; (e) to have one photograph taken; and (f) to have ones oral statements recorded. 2. Directive 2013/32/EU (Recast Asylum Procedures Directive) allows accelerated procedures to be used in cases where applicants have failed to fulfil their obligation. N O P Q R համագործակցելու պարտավորություն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 425
obligation to report BG задължение за докладване CS povinnost se hlásit DE Meldepflicht / Meldeverpflichtung EL υποχρέωση εμφάνισης EN Obligación de presentarse ES ET teavitamiskohustus FI ilmoittautumisvelvollisuus FR obligation de se présenter GA HR obveza javljanja HU jelentési kötelezettség IT obbligo di presentazione LT pareiga pranešti LV pienākums ziņot MT Obbligu li jsir rapport NL Meldplicht; Meldingsplicht (BE) PL obowiązek zgłoszenia PT apresentações periódicas RO obligația de raportare / obligația de a se prezenta SK povinnosť hlásiť sa SL obveznost javljanja SV anmälningsskyldighet NO meldeplikt Definition(s) In the context of return, the obligation of a migrant/ third-country national who is subject to a return decision to report to the (nearest) police or immigration authority or court on a regular basis while awaiting removal from the country. Source(s) EMN Focussed study: The use of detention and alternatives to detention in the context of Immigration policies, 2014. Synonym(s) supervision Related term(s) obligation to cooperate Euro Voc Classification 2811 migration Note(s) 1. This is one of the more frequent alternatives to detention found in national legislation of EU Member States. Reporting duties on a daily, bi-weekly, weekly or even less frequent basis may also be imposed as an additional requirement to the obligation to reside at a specified place. A supervision order may also require the foreigner to surrender their passport or other identity document. 2. The term is also used in the context of detention for reporting obligations of persons pending criminal investigation or released from jail. 3. In the context of international protection, the obligation to cooperate may include the duty of migrants to report to the competent authorities or to appear before them in person; or to inform them of their current place or address. KA ინფორმირების ვალდებულება UK обов’язок звітувати HY 426 հաշվետվություն ներկայացնելու պարտավորություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B occupation BG професия/ занятие CS povolání C D Definition(s) DE Beschäftigung A set of jobs whose main tasks and duties are characterised by a high degree of similarity. E EL επάγγελμα Source(s) F EN occupation ES actividad profesional ET amet FI ammatti FR profession GA gairm bheatha HR zanimanje HU foglalkozás IT professione / occupazione / impiego LT profesija LV profesija MT Impieg / Xogħol / Okkupazzjoni NL beroep PL zawód ILO: ISCO-88, International Standard Classification of Occupations. International Labour Office, Geneva 1990 Related term(s) employment profession H EMN Asylum and Migration Classification I Euro Voc Classification J 3.1 Migration for Economic Purposes 4406 employment K Note(s) 1. Job, in the context of ISCO-08, is defined as follows: A set of tasks and duties performed or meant to be performed, by one person, including for an employer or in self employment. 2. The ISCO definition is also the one used by employment services (placement agencies). L M N PT profissão RO ocupaţie O SK povolanie SL poklic P SV sysselsättning / yrke NO yrke Q KA პროფესია/საქმიანობა R UK професія HY G զբաղմունք S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 427
organised crime BG организирана престъпност CS organizovaný zločin Definition(s) DE organisierte Kriminalität Large-scale and complex illicit activities carried out by an organised criminal group. EL οργανωμένο έγκλημα Source(s) EN organised crime ES delincuencia organizada ET organiseeritud kuritegevus FI järjestäytynyt rikollisuus FR crime organisé GA coireacht eagraithe HR organizirani kriminalitet HU szervezett bűnözés IT crimine organizzato LT organizuotas nusikalstamumas LV organizētā noziedzība Derived by EMN from the IOM Glossary on Migration, 2019. Related term(s) organised criminal group EMN Asylum and Migration Classification 13.3 Crimes related to migration Euro Voc Classification 12 Law Note(s) Such operations are generally carried out with a ruthless disregard of the law, and often involve offences against the person, including threats, intimidation and physical violence. MT Kriminalità (Il-) organizzata NL georganiseerde misdaad PL zorganizowana przestępczość PT crime organizado RO crimă organizată SK organizovaný zločin SL organizirani kriminal SV organiserad brottslighet NO organisert kriminalitet KA ორგანიზებლი დანაშაული UK організована злочинність HY 428 կազմակերպված հանցագործություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B organised criminal group BG организирана престъпна група C D Definition(s) CS skupina organizovaného zločinu DE organisierte kriminelle Gruppe / organisierte kriminelle Vereinigung A structured group of three or more persons, existing for a period of time and acting cooperatively with the aim of committing one or more serious crimes or offences. EL οργανωμένη εγκληματική ομάδα Source(s) EN organised criminal group ES grupo delictivo organizado ET organiseeritud kuritegelik ühendus FI järjestäytynyt rikollisryhmä FR groupe criminel organisé GA buíon choiriúil eagraithe HR organizirana kriminalna skupina HU szervezett bűnözői csoport E F Art. 2(a) of UN Convention against Transnational Organised Crime and the protocols thereto G Related term(s) H EMN Asylum and Migration Classification I Euro Voc Classification J organised crime 13.3 Crimes related to migration 12 Law| 2811 migration K IT gruppo di criminalità organizzata LT organizuota nusikalstama grupė L LV organizēta noziedzīga grupa MT Grupp kriminali organizzat / Għaqda kriminali organizzata M NL criminele organisatie N PL zorganizowana grupa przestępcza O PT grupo de crime organizado RO grup criminal organizat / grupare criminal organizat P SK organizovaná zločinecká skupina SL organizirana kriminalna združba Q SV organiserad brottslig sammanslutning NO organisert kriminell gruppe R KA ორგანიზებული დანაშაულებრივი ჯგუფი UK організоване злочинне угрупування HY S կազմակերպված հանցագործության խումբ T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 429
overstayer BG престой над разрешения срок CS překročení doby povoleného pobytu / osoba s překročenou dobou povoleného pobytu DE Person, die die zulässige Aufenthaltsdauer überschritten hat EL αλλοδαπός υπερβαίνων την επιτρεπόμενη διάρκεια διαμονής EN overstay(er) ES extranjero en situación irregular sobrevenida ET lubatud viibimisaja ületamine / ületaja FI henkilö, joka on jäänyt maahan oleskeluoikeuden umpeuduttua FR personne dépassant la durée de séjour autorisée GA rófhantóir (and overstaying = rófhantóireacht) HR osoba koja je prekoračila dozvoljeno trajanje boravka HU túltartózkodó IT overstayer LT asmuo, viršijęs teisėto buvimo laiką LV persona, kas pārsniedz atļauto uzturēšanās termiņu MT Min itawwal żjara illegalment Definition(s) In the global context, a person who remains in a country beyond the period for which entry was granted. In the EU context, a person who has legally entered but then stayed in an EU Member State beyond the allowed duration of their permitted stay without the appropriate visa (typically 90 days or six months), or of their visa and / or residence permit. Source(s) Global context: Derived by EMN from the entry of overstay in the IOM Glossary on Migration, 2019. EU context: developed by EMN Synonym(s) overstay Broader term(s) third-country national found to be illegally present Related term(s) irregular migrant irregular stay EMN Asylum and Migration Classification NL overstayer 8.1 Right of residence, authorisation of stay/long-term visa, / residence permits PL osoba która utraciła prawo do pobytu Euro Voc Classification PT estrangeiro com excesso de permanência RO persoană care a depășit durata de ședere autorizată / străin cu şedere ilegală (prin depăşirea termenului de şedere conferit de viză sau alt document de şedere) 1011 European Union law| 1231 international law| 2811 migration SK osoba, ktorá prekročila povolenú dobu pobytu SL oseba, ki je prekoračila dovoljeni čas prebivanja SV person som överskridit den tillåtna vistelsen NO person hvis oppholdstillatelse er utløpt (b); person med opphaldsløyve som har gått ut (n) KA ნებადართულზე მეტი ვადით ქვეყანაში მყოფი პირი UK особа, у якої закінчився термін перебування на території іншої країни HY 430 թույլատրված ժամկետից երկար գտնվող EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B Palermo Protocol BG Протоколът от Палермо CS Palermská úmluva DE Palermo-Protokoll EL Πρωτόκολλο του Παλέρμο EN Palermo Protocol ES Protocolo de Palermo ET Palermo protokoll FI Palermon pöytäkirja FR Protocole de Palerme GA Prótacal Palermo HR Protokol iz Palerma HU Palermói Jegyzőkönyv IT Protocollo di Palermo LT Palermo protokolas LV Palermo protokols MT Protokoll (Il-) ta’ Palermo NL Protocol van Palermo PL Protokół z Palermo PT Protocolo de Palermo C D Definition(s) A United Nations (UN) protocol to prevent, suppress and punish trafficking in human beings, especially women and children, supplementing the UN Convention against Transnational Organized Crime and its Protocols. E Source(s) G Related term(s) H EMN Asylum and Migration Classification I Euro Voc Classification J Palermo Protocol trafficking in human beings 13.2 Trafficking in human beings 12 Law| 2811 migration K Note(s) 1. The Protocol was adopted in Palermo, Italy in November 2000. 2. It is one of three protocols supplementing the UN Convention against Transnational Organized Crime. The other two are: ƒ Protocol against the Smuggling of Migrants by Land, Sea and Air (Smuggling Protocol) ƒ Protocol against the Illicit Manufacturing and Trafficking in Firearms, Their Parts and Components and Ammunition (Firearms Protocol) RO Protocolul de la Palermo L M N O SK Palermský protokol SL Palermski protokol P SV Palermoprotokollet NO Palermo-protokollen Q KA პალერმოს ოქმი R UK Палермський протокол HY F Պալերմոյի Արձանագրություն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 431
particular social group BG определена социална група CS konkrétní sociální skupina DE bestimmte soziale Gruppe EL ιδιαίτερη κοινωνική ομάδα EN particular social group ES determinado grupo social ET teatav sotsiaalne rühm FI tietty yhteiskunnallinen ryhmä FR certain groupe social GA grúpa sóisialta áirithe HR posebna društvena skupina HU meghatározott társadalmi csoport IT gruppo sociale determinato LT tam tikra socialinė grupė Definition(s) In the global context, a group of persons who share a common characteristic other than their risk of being persecuted which often is innate, unchangeable, or which is otherwise fundamental to identity, conscience or the exercise of one’s human rights, or who are perceived as a group by society. In the EU-context, a group where in particular members of that group share an innate characteristic, or a common background that cannot be changed, or share a characteristic or belief that is so fundamental to identity or conscience that a person should not be forced to renounce it; and that group has a distinct identity in the relevant country, because it is perceived as being different by the surrounding society. Source(s) PT grupo social específico Global context: Definition of “Membership of a particular social group” from the UNHCR Guidelines on International Protection within the context of Article 1A(2) of the 1951 Convention and/or its 1967 Protocol relating to the Status of Refugees, 2002 EU-context: Art. 10 (1d) of Directive 2011/95/EU (Recast Qualification Directive) RO anumit grup social Synonym(s) LV noteikta sociālā grupa MT grupp soċjali parikulari NL bepaalde sociale groep PL określona grupa społeczna SK určitá sociálna skupina SL določena družbena skupina SV särskild samhällsgrupp NO spesiell sosial gruppe KA გარკვეული სოციალური ჯგუფი UK певна соціальна група HY որոշակի սոցիալական խումբ membership of a particular social group social group Related term(s) gender gender-based persecution gender-specific violence LGB(TI) EMN Asylum and Migration Classification 4.1 International protection| 7. Vulnerable Groups Euro Voc Classification 1011 European Union law| 1231 international law| 2826 social affairs| 7606 United Nations 432 EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. Membership of a particular social group is one of the five Convention grounds for persecution enumerated in Art. 1A(2) of the Geneva Refugee Convention and Protocol. It is the ground with the least clarity and it is not defined by the Convention itself. It is being invoked with increasing frequency in refugee status determinations with States having recognised women, families, tribes, occupational groups, and homosexuals, as constituting a particular social group for the purposes of the Convention. For more information see: UNHCR Guidelines on international protection “Membership of a particular social group» within the context of Article 1A(2) of the 1951 Convention and/or its 1967 Protocol relating to the Status of Refugees . 2. The concept of Directive 2011/95/EU (Recast Qualification Directive) is narrower than that of United Nations High Commissioner for Refugees (UNHCR). 3. Depending on the circumstances in the country of origin, a particular social group might include a group based on a common characteristic of sexual orientation. Sexual orientation cannot be understood to include acts considered to be criminal in accordance with national law of the EU Member States. Gender related aspects, including gender identity, shall be given due consideration for the purposes of determining membership of a particular social group or identifying a characteristic of such a group. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 433
partnership of convenience BG партньорство, сключено с единствената цел да се даде възможност на заинтересованите лица да влязат или да пребивават в държава-членка CS účelové partnerství DE Scheinpartnerschaft EL σύμφωνο συμβίωσης για λόγους συμφέροντος Definition(s) A partnership contracted for the sole purpose of enabling one of the persons concerned to enter or reside in an EU Member State. Source(s) EN partnership of convenience Art. 16(2b) of Council Directive 2003/86/EC (Family Reunification Directive) ES pareja de hecho de conveniencia Related term(s) FR partenariat de complaisance adoption of convenience civil partnership of convenience false declaration of parenthood marriage of convenience GA comhpháirtíocht áise EMN Asylum and Migration Classification ET partnerlus riiki sisenemise eesmärgil / mugavuspartnerlus FI harhautustarkoituksessa solmittu parisuhde HR partnerstvo iz koristi HU névleges élettársi kapcsolat IT relazione stabile fittizia LT fiktyvi partnerystė LV fiktīvas partnerattiecības 3.2 Migration for Family Reasons| 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) Euro Voc Classification 2806 family| 2811 migration MT Sħubija / Unjoni ta’ konvenjenza NL schijnpartnerschap PL partnerstwo dla wygody PT parceria de conveniência RO parteneriat de convenineţă SK účelové partnerstvo SL navidezno partnerstvo / partnerstvo iz koristoljubja SV skenpartnerskap NO proformapartnerskap (b); proformapartnarskap (n) KA ფიქციური პარტნიორობა UK фіктивне партнерство HY 434 պայմանական գործընկերություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B persecution BG преследване CS pronásledování DE Verfolgung EL δίωξη EN persecution ES persecución ET tagakiusamine FI vaino C Serious human rights violations, including a threat to life or freedom, as well as other kinds of serious harm, on account of race, religion, nationality, political opinion or membership of a particular social group. E Source(s) G Narrower term(s) H UNHCR Master Glossary of Terms HU üldöztetés act of persecution actor of persecution Convention grounds for persecution group persecution well-founded fear of persecution IT persecuzione FR persécution GA géarleanúint HR proganjanje D Definition(s) F I J Related term(s) LT persekiojimas serious harm K LV vajāšana EMN Asylum and Migration Classification L MT Persekuzzjoni NL vervolging PL prześladowanie PT perseguição RO persecuţie 4. International Protection and other Types of Protection| 14.1 Political factors and impacts (such as political stability, political climate, public discourse, partly overlap with class 2) Euro Voc Classification SV förföljelse NO forfølgelse (b); forfølging (n) KA დევნა UK переслідування HY հալածանք N 1231 international law| 2811 migration O Note(s) P SK prenasledovanie SL preganjanje M 1. There is no universally accepted definition of persecution and the core concept of persecution was deliberately not defined in the Geneva Refugee Convention and Protocol suggesting that the drafters intended it to be interpreted in a sufficiently flexible manner so as to encompass ever-changing forms of persecution. 2. In addition, lesser forms of harm may cumulatively amount to persecution. Discrimination will also amount to persecution where the effect leads to a situation that is intolerable or substantially prejudicial to the person concerned. 3. Persecution can be related to action by the authorities of the State, but may also emanate from non-state agents, such as armed groups, criminal or organized gangs, family members or the general population, where the State is unable or unwilling to provide protection. Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 435
person eligible for subsidiary protection BG лице, което отговаря на условията за субсидиарна закрила CS osoba, která má nárok na doplňkovou ochranu DE Person mit Anspruch auf subsidiären Schutz EL άτομο που πληροί τις προϋποθέσεις για επικουρική προστασία (EL); άτομο που πληροί τις προϋποθέσεις για συμπληρωματική προστασία (CY) EN person eligible for subsidiary protection ES persona con derecho a protección subsidiaria ET täiendava kaitse saamise nõuetele vastav isik FI henkilö, joka voi saada toissijaista suojelua FR personne pouvant bénéficier de la protection subsidiaire GA duine atá i dteideal cosaint choimhdeach HR osoba koja ispunjava uvjete za supsidijarnu zaštitu HU kiegészítő védelemre jogosult személy IT persona avente titolo a beneficiare della protezione sussidiaria LT papildomą apsaugą galintis gauti asmuo LV persona, kura tiesīga uz alternatīvo statusu MT Persuna eliġibbli għal protezzjoni sussidjarja NL persoon die voor subsidiaire bescherming in aanmerking komt PL osoba kwalifikująca się do ochrony uzupełniającej PT pessoa elegível para proteção subsidiária RO persoană eligibilă pentru protecţie subsidiară SK osoba oprávnená na doplnkovú ochranu SL oseba, upravičena do subsidiarne zaščite Definition(s) A third-country national or a stateless person who does not qualify as a refugee but in respect of whom substantial grounds have been shown for believing that the person concerned, if returned to their country of origin, or in the case of a stateless person, to their country of former habitual residence, would face a real risk of suffering serious harm as defined in Art. 15 of Directive 2011/95/EC (Recast Qualification Directive) and to whom Art. 17(1) and (2) of said Directive do not apply, and is unable, or, owing to such risk, unwilling to avail themselves of the protection of that country. Source(s) Derived by EMN from Art. 2(f) of Directive 2011/95/EC (Recast Qualification Directive) Broader term(s) subsidiary protection Narrower term(s) beneficiary of subsidiary protection real risk of suffering serious harm Related term(s) applicant for international protection beneficiary of international protection civil war refugee EMN Asylum and Migration Classification 4.1.2 Subsidiary protection Euro Voc Classification 1011 European Union law| 2811 migration SV person som uppfyller kraven för att betecknas som subsidiärt skyddsbehövande NO person som har krav på subsidiær beskyttelse (b); person som har krav på subsidiært vern (n) KA პირი, რომელიც აკმაყოფილებს დამატებითი დაცვის მინიჭებისთვის დადგენილ კრიტერიუმებს UK особа, яка має право на додатковий захист HY 436 օժանդակ պաշտպանություն ստանալու իրավունք ունեցող անձ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
person enjoying temporary protection BG лице, ползващо се с временна закрила A B C D Definition(s) CS poživatel dočasné ochrany DE Person, die vorübergehenden Schutz genießt / Person, die temporären Schutz genießt EL άτομο που απολαύει προσωρινής προστασίας A person who has been granted protection according to Directive 2001/55/EC (Temporary Protection Directive). E Source(s) F EN person enjoying temporary protection Derived by EMN from Council Directive 2001/55/EC (Temporary Protection Directive) ES persona beneficiaria de protección temporal Synonym(s) ET ajutise kaitse saaja beneficiary of temporary protection FI tilapäistä suojelua saava henkilö Broader term(s) FR personne bénéficiant de la protection temporaire temporary protection GA tairbhí a theachtann cosaint shealadach Related term(s) G H I J beneficiary of international protection beneficiary of subsidiary protection HR osoba koja uživa privremenu zaštitu HU ideiglenes védelmet élvező személy / átmeneti védelmet élvező személy EMN Asylum and Migration Classification K IT Beneficiario di protezione temporanea 4.3 Temporary protection LT asmuo, kuriam suteikta laikinoji apsauga Euro Voc Classification L 1011 European Union law| 2811 migration LV pagaidu aizsardzību ieguvusī persona MT Persuna tgawdi minn protezzjoni temporanja M Note(s) NL begunstigde van tijdelijke bescherming The European Commission sometimes uses the term ‘beneficiary of temporary protection’ in information on the application of the Directive, e.g. website of DG Migration and Home Affairs: Temporary protection. However, the term beneficiary of temporary protection is not used in the Temporary Protection Directive. PL osoba korzystająca z ochrony czasowej PT Beneficiário de proteção temporária RO persoană care beneficiază de protecție temporară / beneficiar de protecție temporară N O P SK osoba požívajúca dočasnú ochranu (EU acquis); osoba s dočasným útočiskom / osoba s poskytnutým dočasným útočiskom / odídenec Q SL oseba, ki uživa začasno zaščito R SV person som åtnjuter tillfälligt skydd NO Person som har kollektiv beskyttelse (b); person som har kollektivt vern (n) S KA დროებითი დაცვის მქონე პირი T UK особа, яка користується тимчасовим захистом HY U ժամանակավոր պաշտպանությունից օգտվող անձ V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 437
person with a migratory background BG лице с миграционен произход CS osoba s migračním původem DE Person mit Migrationshintergrund EL άτομο με μεταναστευτική καταγωγή (EL); άτομο με μεταναστευτική βιογραφία (CY) EN person with a migratory background ES persona de origen migratorio ET rändetaustaga isik FI maahanmuuttajataustainen henkilö Definition(s) A person who has: (a) migrated into their present country of residence; and / or (b) previously had a different nationality from their present country of residence; and / or (c) at least one of their parents previously entered their present country of residence as a migrant. Source(s) GA duine ag a bhfuil cúlra imirceach Derived by EMN from paragraphs 360-368 in the UN Economic Commission for Europe: Recommendations for the 2010 Censuses of Population and Housing, 2010 HR osoba s migracijskom pozadinom Synonym(s) FR personne issue de l’immigration HU migrációs háttérű személy IT persona con un background migratorio person in a migratory context person of migrant origin LT asmuo, kilęs iš migrantų šeimos arba asmuo, gyvenantis ne savo kilmės valstybėje Narrower term(s) LV persona ar migrācijas pieredzi Euro Voc Classification MT Persuna bi storja ta’ migrazzjoni warajha NL persoon met een migratieachtergrond PL osoba z przeszłością migracyjną PT pessoa com antecedentes migratórios RO persoană cu trecut migraţionist SK osoba s migrantským pôvodom SL oseba z migracijskim ozadjem second-generation migrant 2811 migration Note(s) 1. This is a broad definition which aims to encompass all possibilities for a person who has undertaken a migration at some point and/or has parents who did so. 2. Point (a) can also include a national of the country of residence who previously lived elsewhere and then returned to their country of nationality. SV person med invandrarbakgrund NO person med innvandrerbakgrunn (b); person med innvandrarbakgrunn (n) KA მიგრაციული წარსულის მქონე პირი UK особа з міграційним походженням HY 438 միգրացիոն ծագում ունեցող անձ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
personal interview for international protection BG лично интервю за предоставяне на международна закрила CS osobní pohovor k žádosti o udělení mezinárodní ochrany DE persönliche Anhörung zum Antrag auf internationalen Schutz EL προσωπική συνέντευξη για διεθνή προστασία D E Source(s) G ES entrevista personal para protección internacional Synonym(s) FR entretien personnel sur la demande de protection internationale C Interview with the applicant on the substance of their application for international protection which has to be conducted by the personnel of the determining authority. EN personal interview for international protection FI henkilökohtainen puhuttelu kansainvälisen suojelun menettelyssä B Definition(s) Derived by EMN from Art. 14 of Directive 2013/32/EU (Recast Asylum Procedures Directive) ET isiklik vestlus rahvusvahelise kaitse menetluses A H asylum interview interview in an asylum context personal interview I J EMN Asylum and Migration Classification GA agallamh pearsanta ar mhaithe le cosaint idirnáisiúnta HR saslušanje u postupku odobrenja međunarodne zaštite 6.2.3 First Instance (Administrative) determination procedure K Euro Voc Classification L 12 Law| 2811 migration HU személyes meghallgatás a nemzetközi védelmi igény megállapítására irányuló eljárásban IT colloquio personale per la protezione internazionale LT asmeninis pokalbis dėl tarptautinės apsaugos (EU acquis); prieglobsčio prašytojo asmeninė apklausa LV personiskā intervija (starptautiskās aizsardzības procedūrā) MT Intervista personali għall-protezzjoni internazzjonali NL persoonlijk gehoor/onderhoud over het verzoek om internationale bescherming PL przesłuchanie w procedurze udzielenia ochrony miedzynarodowej PT entrevista pessoal sobre pedido de proteção internacional F M Note(s) 1. The personal interview shall be conducted before a decision is taken by the determining authority and shall take place under certain conditions set out in Art. 15 of Directive 2013/32/EU (Recast Asylum Procedures Directive) . These conditions include: ƒ safeguarding confidentiality and ensuring that ƒ the interviewer is competent and able to take into account of the personal and general circumstances surrounding the application; ƒ wherever possible an interviewer of the same sex as the applicant is provided; ƒ an interpreter is selected who is able to ensure appropriate communication between the interviewer and the applicant; ƒ the interviewer does not wear a military or law enforcement uniform; and ƒ that interviews with minors are conducted in a child-appropriate manner. 2. The term personal interview for international protection is more commonly referred to as an asylum interview. RO interviu individual pentru protecție internațională N O P Q R S T SK osobný pohovor o žiadosti o medzinárodnú ochranu (EU acquis); osobný pohovor o žiadosti o azyl U SL osebni razgovor za mednarodno zaščito V SV personlig intervju för internationellt skydd NO personintervju ved søknad om internasjonal beskyttelse (b); personintervju ved søknad om internasjonalt verm (n) W KA ინდივიდუალური გასაუბრება საერთაშორისო X UK співбесіда для надання міжнародного захисту Y დაცვის მინიჭებასთან დაკავშირებით HY անհատական հարցազրույց միջազգային պաշտպանության համար Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 439
population stock BG брой на населението CS obyvatelstvo (stav k) /počet obyvatel (stav k) Definition(s) DE Bevölkerungs(be)stand The inhabitants of a given area on a certain date (e.g. 1 January or 31 December) of the year in question. EL πληθυσμιακό απόθεμα Source(s) EN population stock ES stock de población ET rahvaarv kindlal territooriumil, teatud aja seisuga FI väestökanta FR stock de population Derived by EMN from the definition of ‘total population’ in the Eurostat Glossary on Demographic Statistics Narrower term(s) migrant stock Related term(s) LT gyventojų skaičius crude rate of net migration migration flow net migration stock of foreigners total migration usually resident population LV iedzīvotāju skaits (1. janvārī) Euro Voc Classification GA stoc daonra HR broj stanovnika HU népességszám IT stock di popolazione MT Rendikont tal-popolazzjoni NL stand van de bevolking; omvang van de bevolking (NL) PL populacja w danym momencie PT stock populacional 2816 demography and population Note(s) The population is based either on data from the most recent census, adjusted by the components of population change produced since the last census, or on population registers. RO stoc de populaţie SK počet obyvateľov SL število prebivalstva SV folkmängd NO folketall (b); folketal (n) KA მოსახლეობის ჯგუფი UK чисельність населення HY 440 բնակչության թվաքանակ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B positive discrimination BG позитивна дискриминация CS pozitivní diskriminace DE positive Diskriminierung EL θετική διάκριση EN positive discrimination ES discriminación positiva C D Definition(s) A policy or a programme providing advantages for certain groups of people who are seen to have traditionally been discriminated against, with the aim of creating a more egalitarian society. E Source(s) G ET eeliskohtlemine Derived by EMN from the FRA (EUMC) Open Glossary (no longer available online) FI positiivinen syrjintä Synonym(s) FR discrimination positive F H GA idirdhealú dearfach affirmative action positive action I HR pozitivna diskriminacija Related term(s) J EMN Asylum and Migration Classification K HU pozitív diszkrimináció IT discriminazione positiva LT pozityvioji diskriminacija LV pozitīva diskriminācija MT Diskriminazzjoni pożittiva NL positieve discriminatie PL dyskryminacja pozytywna PT discriminação positiva RO discriminare pozitivă principle of equal treatment 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) L Euro Voc Classification 1236 rights and freedoms M Note(s) N This consists of preferential access to education, employment, healthcare or social welfare. O SK pozitívna diskriminácia SL pozitivna diskriminacija P SV positiv särbehandling NO positiv diskriminering Q KA პოზიტიური დისკრიმინაცია R UK позитивна дискримінація HY դրական խտրականություն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 441
posted worker BG командирован работник CS vyslaný pracovník DE entsandter Arbeitnehmer EL αποσπασμένος εργαζόμενος EN posted worker ES trabajador desplazado ET lähetatud töötaja FI lähetetty työntekijä FR travailleur détaché GA oibrí ar phostú HR upućeni radnik HU kiküldött munkavállaló IT lavoratore distaccato LT komandiruotas darbuotojas Definition(s) A worker who, for a limited period, carries out his work in the territory of an EU Member State other than the State in which they normally work. Source(s) Art. 2(1) of Directive 96/71/EC (Posting of Workers Directive) EMN Asylum and Migration Classification 3.1 Migration for Economic Purposes Euro Voc Classification 2811 migration| 4406 employment Note(s) A posted worker is also one of the forms of ‘trade in services mode 4’ according to the General Agreement on Trade in Services (GATS). LV darba ņēmējs, kurš norīkots darbā citā dalībvalstī MT Ħaddiem stazzjonat / ippostjat NL ter beschikking gestelde werknemer PL pracownik oddelegowany PT trabalhador destacado RO lucrător detaşat SK vyslaný pracovník SL napoteni delavec SV utstationerad arbetstagare NO utsatt effektuering / iverksettelse (b); utsett effektuering / iverksetjing (n) KA ევროკავშირის ფარგლებში დასაქმებული ევროკავშირის მოქალაქე UK відряджений працівник HY 442 գործուղված աշխատող EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B postponement of removal BG отлагане на извеждането C D Definition(s) CS odklad vyhoštění DE einstweilige Aussetzung der Abschiebung (EU acquis); vorübergehende Aussetzung der Abschiebung / Duldung (AT, DE); Aufschub der Abschiebung (LU) EL αναβολή απομάκρυνσης EN postponement of removal ES aplazamiento de la expulsión ET väljasaatmise edasilükkamine FI maastapoistamisen lykkääminen FR report de l’éloignement (Temporary) suspension of removal of a third-country national who has received a return decision but whose removal is not possible either for humanitarian reasons (as their removal would violate the principle of nonrefoulement or due to the third-country national›s physical state or mental capacity) or for technical reasons (such as lack of transport capacity or failure of the removal due to lack of identification or the country of origin›s refusal to accept the person) and for as long as a suspensory effect is granted in accordance with Art.13(2) of Directive 2008/115/EC (Return Directive). Source(s) GA an t-aistriú a chur siar HR privremena odgoda prisilnog udaljenja Derived by EMN from Art. 9 of Directive 2008/115/EC (Return Directive) HU a kitoloncolás elhalasztása Synonym(s) LT išsiuntimo atidėjimas (EU acquis); išsiuntimo vykdymo sustabdymas suspension of removal temporary suspension of removal tolerated stay LV piespiedu izraidīšanas atlikšana Euro Voc Classification IT rinvio dell’allontanamento NL uitstel van verwijdering RO amânarea îndepărtării SK odklad odsunu (EU acquis); tolerovaný pobyt SL odložitev odstranitve I M N SV uppskov med avlägsnande O P Q R NO utsatt uttransportering (b); utsett uttransportering (n) KA გაძევების გადავადება S UK відстрочка вилучення HY H L 1. Tolerated stay status is granted in a number of EU Member States with differing definitions and regulated by different legal instruments. The toleration is only a suspension of removal. 2. In several EU Member States, the term ‘tolerated stay’ is not formally used anymore and has been replaced by ‘postponment of removal’ after the transposition of Directive 2008/115/EC (Return Directive) . 3. For more information, see EMN: Alternatives to Detention, 2014 . PT adiamento do afastamento G K Note(s) PL wstrzymanie wydalenia F J 12 Law| 2811 migration MT Posponiment ta’ tneħħija E վտարման հետաձգում T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 443
Prague Process BG Пражки процес CS Pražský proces DE Prager Prozess EL Διαδικασία της Πράγας EN Prague Process ES Proceso de Praga ET Praha protsess FI Prahan prosessi FR Processus de Prague GA Próiseas Phrág HR Praški proces HU Prágai Folyamat IT Processo di Praga LT Prahos procesas LV Prāgas process MT Proċess (Il-) ta’ Praga NL Praag Proces PL Proces Praski PT Processo de Praga RO Procesul Praga / Procesul de la Praga SK Pražský proces SL Praški proces SV Pragprocessen NO Praha-prosessen KA პრაღის პროცესი UK Празький процес HY 444 Պրահյան գործընթաց Definition(s) A targeted migration dialogue and a policy process promoting migration partnerships among the countries of the European Union, Schengen Area, Eastern Partnership (EAP), Western Balkans, Central Asia, Russia and Turkey. Source(s) Website of the Prague Process Synonym(s) Prague Process -Building Migration Partnerships Related term(s) Global Approach to Migration and Mobility (GAMM) EMN Asylum and Migration Classification 15.1 EU External dimension of migration and mobility Euro Voc Classification 10 European Union Note(s) 1. The Process originated from the EU financed project “Building Migration Partnerships”, and was initiated during the Czech EU Presidency at the 1st Prague Process Ministerial Conference with the endorsement of the Prague Process Joint Declaration in April 2009. 2. In the Joint Declaration, serving as a common political framework, the participating states agreed to strengthen co-operation in migration management, to explore and develop agreed principles and elements for close migration partnerships between their countries, following a comprehensive, balanced, pragmatic and operational approach, and respecting the rights and human dignity of migrants and their family members, as well as of refugees. 3. The main principles and cooperation areas are set by Joint Declarations which are updated in regular intervals. They include: ƒ preventing and fighting irregular migration; ƒ readmission, voluntary return and sustainable reintegration; ƒ legal migration with a special emphasis on labour migration; ƒ integration of legally residing migrants; ƒ migration, mobility and development; ƒ strengthening capacities in the area of asylum and international protection. 4. All six cooperation areas mirror to a certain extent objectives of the Global Approach to Migration and Mobility (GAMM), being the overarching framework of the EU external migration and asylum policy. In the context of the GAMM the Prague Process has been given a priority as a regional dialogue process towards the East. 5. In addition to this dialogue, the Prague Process engages in: ƒ The Migration Observatory which aims to provide impartial, evidence-based analysis from across the Prague Process region and in line with the six thematic areas of the Prague Process Action Plan; ƒ The Training Academy which aims to provide tailor-made, targeted, high-quality trainings in line with the six thematic areas 6. For more information see the website of the Prague Process. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B preparatory class BG подготвителен клас / подготвителен учебен час CS přípravný kurz EL Προπαρασκευαστικά μαθήματα (συν. τάξεις υποδοχής) ES ET ettevalmistusklass FI valmistava luokka / valmistava opetus FR cours préparatoire / classe préparatoire; classe d’accueil / cours d’accueil (LU) GA HR pripremna nastava HU előkészítő óra / előkészítő osztály IT corso di preparazione LT parengiamieji kursai LV sagatavošanas klase MT Separate classes or lessons in which newly arrived migrant children are provided with intensive language teaching and, in some cases, an adapted curriculum for other subjects,in order to facilitate their integration in the regular school system. Source(s) Derived by EMN from Eurydice Report: Integrating Students from Migrant Backgrounds into Schools in Europe: National Policies, 2019. PL zajęcia przygotowawcze PT RO clasă pregătitoare SK prípravný kurz SL pripravljalni pouk SV förberedande undervisning / förberedelseklass NO forberedende språkkurs (for barn av nyankomne asylsøkere) (b); førebuande språkkurs (for barn av nyankomne asylsøkarar) (n) KA მოსამზადებელი კურსი UK підготовче заняття E F G H I Synonym(s) J education for immigrant children education for migrant children reception class transition class welcome class K L EMN Asylum and Migration Classification M 9.1 Integration measures Euro Voc Classification NL HY D Definition(s) DE Vorbereitungsklasse / Vorbereitungskurs; Aufnahmeklasse / Aufnahmekurs (LU) EN preparatory class C N 28 Social Questions| 2811 migration O Note(s) 1. Art.14(2)2 of Directive 2013/33/EU (Recast Reception Conditions Directive) stipulates that “preparatory classes, including language classes, shall be provided to minors where it is necessary to facilitate their access to and participation in the education system. 2. However there is a diverging practice towards preparatory classes and/ or lessons among EU Members States. Most EU Member States place newly arrived children and young people with a migratory background in preparatory classes or lessons if their language skills are not strong enough to follow mainstream teaching. Others place migrant children directly in regular/mainstream classes, as they consider this practice to be the most appropriate for integration. For more information see the Eurydice Report: Integrating Students from Migrant Backgrounds Education and Training into Schools in Europe: National Policies, August 2019. նախապատրաստական ​​դասընթացներ P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 445
presumed victim of trafficking in human beings BG предполагаема жертва на трафика на хора CS pravděpodobná oběť obchodování s lidmi DE vermutetes Opfer von Menschenhandel EL φερόμενο θύμα εμπορίας ανθρώπων (EL); φερόμενο θύμα εμπορίας προσώπων (CY) EN presumed victim of trafficking in human beings ES presunta victima de trata de seres humanos Definition(s) A person who has met the criteria of EU regulations and international Conventions but has not been formally identified by the relevant authorities (e.g. police) as a trafficking victim or has declined to be formally or legally identified as trafficked. Source(s) ET eeldatav inimkaubanduse ohver Derived by EMN from Eurostat: Trafficking in human being, 2015 FI oletettu ihmiskaupan uhri Related term(s) FR victime présumée de la traite des êtres humains HR potencijalne žrtve trgovanja ljudima identified victim of trafficking in human beings trafficking in human beings vulnerable person HU emberkereskedelem feltételezett áldozata EMN Asylum and Migration Classification GA duine ar dócha gur íospartach gáinneála é / í IT vittima presunta di tratta di esseri umani 13.2 Trafficking in human beings LT asmuo, galėjęs nukentėti nuo prekybos žmonėmis Euro Voc Classification LV persona, kuru uzskata par cilvēku tirdzniecības upuri MT Preżumibbilment vittma fit-traffikar tal-persuni NL vermoedelijk slachtoffer van mensenhandel PL domniemana ofiara handlu ludźmi PT presumível vítima de tráfico de seres humanos 12 Law| 2811 migration Note(s) If a person is presumed to be a victim of trafficking in human beings, this does not rule out the possibility that the person’s status will later be assessed otherwise (i.e. not identified / confirmed as a victim). RO presupuse victime ale traficului de fiinţe umane SK pravdepodobná obeť obchodovania s ľuďmi / formálne neidentifikovaná obeť obchodovania s ľuďmi SL domnevna žrtev trgovine z ljudmi SV förmodat offer för människohandel NO antatt offer for menneskehandel KA ადამიანით ვაჭრობის (ტრეფიკინგის) სავარაუდო მსხვერპლი UK ймовірна жертва торгівлі людьми HY 446 մարդկանց թրաֆիքինգի ենթադրյալ զոհ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B prima facie refugee BG no translation CS uprchlík prima facie C D Definition(s) ES refugiado (prima facie) Person recognised as a refugee, by a State or the United Nations High Commissioner for Refugees (UNHCR), on the basis of objective criteria related to the circumstances in their country of origin, which justify a presumption that they meet the criteria of the applicable refugee definition. ET prima facie pagulane Source(s) DE Prima-Facie Flüchtling EL εκ πρώτης όψεως πρόσφυγας EN prima facie refugee FI prima facie -pakolainen UNHCR Master Glossary of Terms FR réfugié prima facie Broader term(s) GA dídeanaí prima facie refugee HR izbjeglica prima facie Related term(s) HU prima facie alapon elismert menekült IT rifugiato prima facie LT prima facie pabėgėlis LV prima facie bēglis MT Rifuġjat(a) prima facie NL prima facie vluchteling PL uchodźca prima facie PT refugiado prima facie F G H I J group determination of refugee status group persecution K EMN Asylum and Migration Classification 4.1.1 Refugee protection L Euro Voc Classification 1231 international law| 2811 migration M Note(s) N This term refers to a more theoretical concept and is often not applied. RO refugiat prima facie O SK utečenec prima facie SL prima facie begunec P SV prima facie-flykting NO prima facie-flyktning Q KA პრიმა ფაციე (prima facie/”ერთი შეხედვით”) ლტოლვილი R UK біженець prima facie HY E S առերևույթ փախստական T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 447
principle of equal treatment BG принцип на равно третиране CS princip rovného zacházení DE Gleichbehandlungsgrundsatz EL αρχή της ίσης μεταχείριση EN principle of equal treatment ES principio de igualdad de trato ET võrdse kohtlemise põhimõte FI yhtäläisen kohtelun periaate FR principe d’égalité de traitement GA an prionsabal um chóir chomhionann HR načelo jednakog postupanja Definition(s) The principle that there shall be no direct or indirect discrimination based on racial or ethnic origin, sex, religion or belief, disability, age or sexual orientation. Source(s) Derived by EMN from Art. 2 of Council Directive 2000/43/EC (Racial Equality Directive) and Art. 13 of the Treaty of Amsterdam Synonym(s) equal opportunities Narrower term(s) HU egyenlő bánásmód elve direct discrimination indirect discrimination IT principio di parità di trattamento Related term(s) LT vienodo požiūrio principas LV vienlīdzīgas attieksmes princips positive discrimination victimisation MT Prinċipju (Il-) ta’ trattament ugwali EMN Asylum and Migration Classification NL beginsel van gelijke behandeling PL zasada równego traktowania PT princípio da igualdade de tratamento RO principiul tratamentului egal SK zásada rovnakého zaobchádzania / princíp rovnakého zaobchádzania SL načelo enakega obravnavanja SV principen om likabehandling NO prinsippet om likebehandling KA თანასწორი მოპყრობის პრინციპი UK принцип рівного ставлення HY 448 հավասար վերաբերմունքի սկզբունք 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) Euro Voc Classification 1236 rights and freedoms Note(s) 1. This is an important right conferred by EU citizenship. The Treaty of Amsterdam added a new Art. 13 to the Treaty, reinforcing the principle of non-discrimination. Under this article, the Council has the power to take appropriate action to combat discrimination based on sex, racial or ethnic origin, religion or belief, disability, age or sexual orientation. 2. The term ‘equal treatment’ has a distinct use / meaning when used in the context of bilateral social security agreements between EU Member States as per Regulation (EU) No 465/2012 on the coordination of social security systems. 3. For more information see EMN: Migrant Access to Social Security and Healthcare -policy and practice, 2014 . EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B procedural guarantees BG процедурни гаранции C D Definition(s) CS procesní záruky ES garantías procedimentales In the EU asylum context, special guarantees addressing the legal rights of applicants for international protection as outlined in Chapter II of Directive 2013/32/EU (Recast Asylum Procedures Directive) and Art. 6 of the European Convention of Human Rights (ECHR). ET menetlustagatised Source(s) DE Verfahrensgarantien EL διαδικαστικές εγγυήσεις EN procedural guarantees FR garanties procédurales GA ráthaíochtaí nós imeachta J procedural safeguards HU eljárási garanciák Broader term(s) IT garanzie procedurali K procedure for international protection LT procedūrinės garantijos EMN Asylum and Migration Classification LV procesuālās garantijas MT Garanziji proċedurali 6.2 Procedure for international protection/Refugee status determination NL procedurele waarborgen Euro Voc Classification PL gwarancje proceduralne 1231 international law| 2811 migration Note(s) SK procesné záruky / procedurálne záruky SL postopkovna jamstva SV förfarandegarantier NO saksbehandlingsgaranti (b); sakshandsamingsgaranti (n) KA პროცედურული გარანტიები UK процедурні гарантії HY ընթացակարգային երաշխիքներ L M N PT garantias processuais RO garanții procedurale G I Synonym(s) HR postupovna jamstva F H Chapter II of Directive 2013/32/EU (Recast Asylum Procedures Directive) and Art. 6 of the European Convention of Human Rights FI menettelylliset takeet E These guarantees comprise the following rights of applicants for international protection: access to the procedure for international protection; right to remain in the Member State pending the examination of the application for international protection; information on their rights and obligations in a language they understand; acess to interpreters; the opportunity to communicate with the United Nations High Commissioner for Refugees (UNHCR) or with any other organisation providing legal advice or other counselling; notice in reasonable time of the decision by the determining authority on their application; a personal interview, and free legal assistance and representation granted on request in the appeals procedures (including the preparation of the required procedural documents and participation in the hearing before a court or tribunal of first instance on behalf of the applicant. O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 449
procedure for international protection BG производство за предоставяне на международна закрила CS řízení o udělení mezinárodní ochrany DE Verfahren auf internationalen Schutz EL διαδικασία σχετικά με τη διεθνή προστασία EN procedure for international protection ES procedimiento para la protección internacional ET rahvusvahelise kaitse menetlus FI kansainvälistä suojelua koskeva menettely FR procédure de demande d’une protection internationale Definition(s) Set of measures described in the Directive 2013/32/ EU (Recast Asylum Procedures Directive) which encompasses all necessary steps for granting and withdrawing international protection starting with making an application for international protection to the final decision in appeals procedures. Source(s) Developed by EMN Synonym(s) HU nemzetközi védelemre vonatkozó eljárás asylum procedure protection determination procedure refugee determination procedure RSD procedure international protection determination procedure IT procedura di protezione internazionale Narrower term(s) GA Nós imeachta maidir le cosaint idirnáisiúnta HR postupak za međunarodnu zaštitu LT tarptautinės apsaugos procedūra (EU acquis); prieglobsčio procedūra LV starptautiskās aizsardzības procedūra MT Proċedura għall-protezzjoni internazzjonali NL procedure voor de toekenning van internationale bescherming PL procedura udzielania ochrony międzynarodowej PT Procedimento de concessão e retirada do estatuto de proteção internacional RO procedura de protecție internațională / procedura privind protecția internațională SK procedúra medzinárodnej ochrany / konanie o medzinárodnej ochrane (EU acquis); konanie o udelenie azylu / konanie o azyle SL postopek mednarodne zaščite SV förfarande för att pröva internationellt skydd NO prosedyre ved søknad om internasjonal beskyttelse (b); prosedyre ved søknad om internasjonalt vern (etter søknad om internasjonalt vern) (n) KA საერთაშორისო დაცვის პროცედურა UK процедура надання міжнародного захисту HY 450 access to the procedure for international protection examination of an application for international protection personal interview for international protection EMN Asylum and Migration Classification 6.2 Procedure for international protection/Refugee status determination Euro Voc Classification 12 Law| 2811 migration Note(s) 1. These steps are in particular: making and lodging an application for international protection, registration of the applicant and establishment of the applicant’s identity by means of identification, examination of the application including the personal interview, decision at first instance, appeals procedure and final decision in the appeals procedure. The procedures include special procedures such as the Dublin procedure or accelerated procedures as well as the distribution and accommodation of the applicants. 2. Directive 2013/32/EU(Recast Asylum Procedures Directive) provides the framework for a single application procedure comprising common guarantees and standards for the qualification of third-country nationals or stateless persons as beneficiaries of international protection, or for persons eligible for subsidiary protection and for the content of the protection granted in order to complete the establishment of a Common European Asylum System (CEAS). միջազգային պաշտպանության վերաբերյալ ընթացակարգ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B protection BG закрила CS ochrana DE Schutz EL άτομο που απολαύει προσωρινής προστασίας EN protection ES protección ET kaitse FI suojelu C D Definition(s) A concept that encompasses all activities aimed at obtaining full respect for the rights of the individual in accordance with the letter and spirit of human rights, refugee and international humanitarian law. E Source(s) G Narrower term(s) H UNHCR Master Glossary of Terms IT protezione actor of protection humanitarian protection international protection regional development and protection programme (RDPP) subsidiary protection temporary protection LT apsauga Related term(s) FR protection GA cosaint HR zaštita HU védelem LV aizsardzība asylum MT Protezzjoni / Ħarsien EMN Asylum and Migration Classification 4. International Protection and other Types of Protection PL ochrona Euro Voc Classification RO protecţie SK ochrana SL zaščita SV skydd J K M 1231 international law| 2811 migration N Note(s) O Protection involves creating an environment conducive to respect for human beings, preventing and / or alleviating the immediate effects of a specific pattern of abuse, and restoring dignified conditions of life through reparation, restitution and rehabilitation. NO beskyttelse (b); vern (n) P Q KA დაცვა R UK захист HY I L NL bescherming PT protecção F պաշտպանություն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 451
Public Register of Authentic Travel and Identity Documents Online (PRADO) BG Публичен онлайн регистър за автентични документи за пътуване и самоличност LV autentisku personu apliecinošu un ceļošanas dokumentu publiskais reģistrs tiešsaistē CS Veřejný rejstřík pravých dokladů totožnosti a cestovních dokladů online MT Reġistru Pubbliku Online ta’ Dokumenti Awtentiċi tal-Identità u l-Ivvjaġġar DE Öffentliches online-Register echter Identitäts- und Reisedokumente NL Openbaar onlineregister van authentieke reis- en identiteitsdocumenten EL Διαδικτυακό δημόσιο μητρώο γνήσιων εγγράφων ταυτότητας και ταξιδιωτικών εγγράφων (PRADO) PL Publiczny Rejestr Autentycznych Dokumentów Tożsamości i Podroży EN Public Register of Authentic Travel and Identity Documents Online (PRADO) PT Registo Público on-line de Documentos Autênticos de Identidade e de Viagem ES Registro público en línea de documentos auténticos de identidad y de viaje RO Registrul public online al documentelor autentice de identitate și de călătorie ET Ehtsate isikut tõendavate ja reisidokumentide avalik veebiregister SK Verejný register pravých dokladov totožnosti a cestovných dokladov online (PRADO) FI Julkinen aitojen matkustus- ja henkilöasiakirjojen sähköinen tietokanta (PRADO) SL Spletni javni register pristnih osebnih in potnih listin (PRADO) FR Registre public en ligne de documents authentiques d’identité et de voyage (PRADO) SV det offentliga registret över äkta identitets- och resehandlingar online / PRADO GA an Clár Poiblí ar Líne de Dhoiciméid Bharántúla Aitheantais agus Taistil NO nettbasert referansedatabase for identitets- og reisedokumenter (b); nettbasert referansedatabase for identitets- og reisedokument (n) HR Javni internetski registar vjerodostojnih osobnih i putnih isprava (PRADO) HU Eredeti úti és személyazonosító okmányok nyilvános online adatbázisa IT Registro pubblico online dei documenti di identità e di viaggio autentici LT Autentiškų tapatybės ir kelionės dokumentų internete viešas registras 452 KA ავთენტიკური სამგზავრო და პირადობის დამადასტურებელი დოკუმენტების საჯარო ონლაინრეესტრი (PRADO) UK Відкритий онлайн-реєстр справжніх документів, що посвідчують особу, і проїзних документів (PRADO) HY EMN ASYLUM AND MIGRATION GLOSSARY 10.0 Ճանապարհորդության և անձը հաստատող փաստաթղթերի առցանց գրանցամատյան
A B C D Definition(s) E A reference database containing information about authentic travel and identity documents and other important documents issued by authorities from EU Member States and Schengen countries and some third countries. F G Source(s) Public Register of Authentic travel and identity Documents Online: official website H Synonym(s) I PRADO Broader term(s) J Euro Voc Classification K False and Authentic Documents Online (FADO) 1011 European Union law| 2811 migration L Note(s) 1. PRADO is the publically available component of FADO. 2. The database/website contains images and multilingual summary information on some of the most commonly used identity documents (such as driving licences, civil status documents, residence and work permits) of the EU Member States and some third countries. Users may find a full description of the most important and the easily-checkable security features of these documents, like watermarks, security threads and more. 3. The information is selected and provided by document experts in the EU Member States, IC, NO and CH. M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 453
pull factor BG притегателен фактор CS pull faktor Definition(s) DE Pull-Faktor The condition(s) or circumstance(s) that attract a migrant to another country. EL πόλος έλξης Source(s) EN pull factor Derived by EMN from IOM Glossary on Migration, 2019. ES factor de atracción Broader term(s) ET tõmbefaktor push-pull factor FI vetotekijä Related term(s) FR facteur d’attraction push factor GA toisc tharraingthe EMN Asylum and Migration Classification HR čimbenik privlačenja 14. Factors and Impacts of Migration HU pull faktor / ösztönző tényező Euro Voc Classification IT fattore di attrazione LT traukos veiksnys LV pievilkšanas faktors MT Fattur t’attrazzjoni / ta’ ġibda NL pull factor / aantrekkende factor 2811 migration Note(s) As recognised by the project European Reintegration Networking, this can be for a specific or a variety of reasons, e.g. expanding economic opportunities and potential for advancement in the country of destination. PL czynnik przyciągający PT fator de atração / pull factor RO factor de atragere / pull factor SK stimulačný faktor / pull faktor SL dejavnik potega / dejavnik privlačevanja SV pull-faktor NO trekkfaktor KA მიგრაციის მიმზიდველი (pull) ფაქტორი UK фактор, який стимулює міграційний притік / фактор притягування HY 454 ձգող գործոն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B push back C BG отблъскване CS pushback DE Pushback (no usual translation) / illegales Zurückdrängen von Migranten EL Επαναπροώθηση EN push back ES retroceso forzado ET tagasitõrjumine FI pushback-toiminta FR refoulement / push back / renvoi illégal de migrants HR pushback HU push back LV novirzīšana atpakaļ MT push back NL pushback PT reenvio forçado SK vytláčanie migrantov na vonkajších hraniciach / push back HY հետադարձ (ետ մղել) F G H J K L Related term(s) M EMN Asylum and Migration Classification N 13. Irregular Migration| 13.3 Crimes related to migration RO respingere la frontieră / împins înapoi UK видворення I non-refoulement PL push back KA უკან გაბრუნება Source(s) pushback push-back push back at sea LT apgręžimas NO push back E Synonym(s) IT respingimento SV push back Various measures taken by states which result in migrants, including applicants for international protection, being summarily forced back to the country from where they attempted to cross or have crossed an international border without access to international protection or asylum procedures or denied of any individual assessment on their protection needs which may lead to a violation of the principle of nonrefoulement. Derived by EMN from Special Rapporteur on the human rights of migrants: Report on means to address the human rights impact of pushbacks of migrants on land and at sea, 12 May 2021. GA brú siar SL nezakonito zavračanje D Definition(s) Euro Voc Classification 2811 migration O P Note(s) 1. While there is no internationally agreed legal definition of the term push back in the area of migration, it can be understood as behaviour violating the general rule of non-refoulement. 2. Art. 18 of the Charter of Fundamental Rights of the European Union guarantees the right to asylum and Art. 19 prohibits collective expulsions. This article as well as Art. 3 of the European Convention on Human Rights (ECHR) prohibit to remove, expel or extradite an individual to a State where there is a serious risk that they would be subjected to the death penalty, torture or other inhuman or degrading treatment or punishment. They can also apply extraterritorially, e.g. if EU Agencies operate outside EU territory. 3. Directive 2011/95/EU (Recast Qualification Directive) codifies in Art. 21(1) the principle of non-refoulement as defined in Art. 33 of the Geneva Refugee Convention and Protocol and prohibits EU Member States expelling an individual declaring the will of applying for international protection to a country where they face a real risk of persecution. Art. 78 of the Treaty on the Functioning of the European Union (TFEU) stipulates that the EU must provide a common policy for asylum, subsidiary protection and temporary protection with a view to offering appropriate status to any third-country national requiring international protection and ensuring compliance with the principle of non-refoulement. 4. For more information see: European Parliament: Briefing Pushbacks at the EU’s external borders. Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 455
push factor BG отблъскващ фактор CS push faktor Definition(s) DE Push-Faktor The condition(s) or circumstance(s) in a country of origin that impel or stimulate emigration. EL παράγοντας απώθησης Source(s) EN push factor Derived by EMN from IOM Glossary on Migration, 2019. ES factor de expulsión Broader term(s) ET tõukefaktor push-pull factor FI työntötekijä Related term(s) FR facteur de répulsion / facteur de rejet pull factor GA toisc bhrú EMN Asylum and Migration Classification HR čimbenik odbijanja HU push faktor / kényszerítő tényező IT fattore di spinta LT stūmimo veiksnys LV atgrūšanas faktors MT Fattur ta’ ripulsjoni / ta’ tbarrija NL push factor / afstotende factor 1. Framework Concepts on Migration (including root causes of migration| 14. Factors and Impacts of Migration Euro Voc Classification Note(s) As recognised by the project European Reintegration Networking, this can be for a specific or a variety of reasons, e.g. declining economic opportunities or political instability may stimulate emigration. PL czynik wypychający PT fator de afastamento / push factor RO factor de împingere / push factor SK nútiaci faktor / push faktor SL dejavnik potiska / dejavnik odbijanja SV push-faktor NO skyvfaktor (b); skuvfaktor (n) KA მიგრაციის მაიძულებელი (push) ფაქტორი UK фактор, який стимулює міграційний відтік / фактор виштовхування HY 456 վանող գործոն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B push-pull factor C BG фактори на привличане и отблъскване CS push-pull faktor DE Push-Pull-Faktor EL παράγοντας απώθησης και έλξης EN push-pull factor ES factores de expulsión / atracción Factors which initiate and influence the decision to migrate, either by attracting them to another country (pull factors) or by impelling or stimulating emigration (push factors). E Source(s) G Narrower term(s) H FI työntö- ja vetotekijä FR facteur de répulsion et d’attraction / facteur de rejet et d’attraction pull factor push factor HU push-pull faktor / kényszertő-ösztönző tényező IT fattore di spinta-attrazione Euro Voc Classification LT stūmimo-traukos veiksnys I EMN Asylum and Migration Classification 1. Framework Concepts on Migration (including root causes of migration| 14. Factors and Impacts of Migration HR čimbenik odbijanja-privlačenja F Developed by EMN ET tõuke-tõmbefaktor GA toisc bhrú is tarraingthe D Definition(s) J K 2811 migration L LV atgrūšanas-pievilkšanas faktors / motivētājfaktors MT Fattur ta’ ripulsjoni-attrazzjoni / ta’ ġibda-tbarrija M NL push-pull factor N PL czynnik wypychający i przyciągający PT fator de afastamento - fator de atração O RO factor de împingere-atracție / push-pull factor SK motivačný faktor / push-pull faktor P SL dejavnik potiska in potega / dejavnik odbijanja in privlačevanja Q SV push- och pull-faktor NO skyv-trekk-faktor (b); skuv-trekk-faktor (n) KA მიგრაციის მამოძრავებელი (push-pull) R UK фактор притягування-виштовхування S ფაქტორები HY վանող-ձգող գործոն T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 457
quota BG квота CS kvóta Definition(s) DE Quote In the migration context, a quantitative restriction on the number of migrants admitted into a State. EL ποσόστωση Source(s) EN quota Developed by EMN ES cuota Narrower term(s) ET piirarv immigration quota FI kiintiö Related term(s) FR quota managed migration GA cuóta Euro Voc Classification HR kvota HU kvóta IT quota LT kvota 2811 migration Note(s) Many countries establish quotas, or caps, on the number of migrants to be admitted each year. LV kvota MT Kwota NL quotum PL kwota PT quota RO cotă SK kvóta SL kvota SV kvot NO kvote KA კვოტა UK Квота HY 458 բաժնեչափ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B Rabat Process BG процес от Рабат CS Rabatský proces DE Rabat-Prozess EL Διαδικασία του Ραμπάτ EN Rabat Process ES Proceso de Rabat ET Rabati protsess FI Rabatin prosessi FR Processus de Rabat GA Próiseas Rabat HR Rabatski proces C A framework for dialogue and consultation between EU Member States and African countries from North, West and Central Africa, as well as the European Commission and the Economic Community of West African States (ECOWAS), focusing on regional cooperation in the field of migration between countries of origin, transit and destination along current migration routes and within which concrete, practical initiatives are implemented. Source(s) Synonym(s) IT Processo di Rabat LT Rabato procesas Related term(s) LV Rabātas process MT Proċess (Il-) ta’ Rabat NL Rabat-proces / Proces van Rabat PL Proces rabacki PT Processo de Rabat RO Procesul de la Rabat SK Rabatský proces / Euro-africký dialóg o migrácii a rozvoji SL Rabatski proces / Evroafriški dialog o migracijah in razvoju SV Rabatprocessen NO Den europeisk-afrikanske dialogen om migrasjon F G H J K European Union Emergency Trust Fund for Africa (EUTF for Africa) Global Approach to Migration and Mobility (GAMM) Khartoum Process L EMN Asylum and Migration Classification N Euro Voc Classification O 15.1 EU External dimension of migration and mobility 04 Politics| 2811 migration M P Note(s) 1. The Euro-African Migration and Development process started with a ministerial conference in Rabat in 2006. 2. For more information, see the Website of the Rabat Process. KA რაბატის პროცესი UK Рабатський процес HY E I Website of the Rabat Process Euro-African Dialogue on Migration and Development Euro-African Ministerial Conference on Migration and Development HU Rabati Folyamat D Definition(s) Q R S Ռաբաթի գործընթաց T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 459
racial discrimination BG расова дискриминация CS rasová diskriminace DE rassistische Diskriminierung / Rassendiskriminierung EL φυλετική διάκριση EN racial discrimination ES discriminación racial ET rassiline diskrimineerimine FI rotusyrjintä FR discrimination raciale GA idirdhealú ciníoch HR rasna diskriminacija HU faji diszkrimináció IT discriminazione razziale LT rasinė diskriminacija LV rasu diskriminācija MT Diskriminazzjoni razzjali Definition(s) Any distinction, exclusion, restriction or preference based on race, colour, descent, or national or ethnic origin which has the purpose or effect of nullifying or impairing the recognition, enjoyment or exercise, on an equal footing, of human rights and fundamental freedoms in the political, economic, social, cultural or any other field of public life. Source(s) Art. 1(1) of UN Convention on the Elimination of All Forms of Racial Discrimination Broader term(s) discrimination Related term(s) racism xenophobia EMN Asylum and Migration Classification NL rassendiscriminatie 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) PL dyskryminacja rasowa Euro Voc Classification PT discriminação racial RO discriminare rasială SK rasová diskriminácia SL rasna diskriminacija SV rasdiskriminering NO rasediskriminering KA რასობრივი დისკრიმინაცია UK расова дискримінація HY 460 1236 rights and freedoms Note(s) 1. The Convention does not define ‘race’ but it does define ‘racial discrimination’. 2. Distinctions made on the basis of citizenship (that is, between citizens and non-citizens) are specifically excluded from the definition, as are affirmative action policies and other measures taken to redress imbalances and promote equality. 3. Some institutions such as the United Nations High Commissoner for Refugees (UNHCR) and the European Union Agency for Asylum (EUAA) use the term ‘discrimination’ with the same definition. ռասայական խտրականություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B racism BG расизъм CS rasismus C D Definition(s) DE Rassismus Ideas or theories of superiority of one race or group of persons of one colour or ethnic origin. E EL ρατσισμός Source(s) F EN racism ES racismo ET rassism FI rasismi FR racisme GA ciníochas HR rasizam HU rasszizmus IT razzismo Art. 4 of UN Convention on the Elimination of All Forms of Racial Discrimination Related term(s) racial discrimination xenophobia H EMN Asylum and Migration Classification I 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) J Euro Voc Classification 28 Social Questions K Note(s) L LT rasizmas LV rasisms MT Razziżmu NL racisme PL rasizm PT racismo RO rasism SK rasizmus SL rasizem SV rasism NO rasisme KA რასიზმი UK расизм HY ռասիզմ G 1. Racism can be defined in many ways. A broad, general definition is used here in order to have a common understanding of the concept. However, there is a problem in that the term ‘racism’ presupposes the existence of different races. Recital (6) of Directive 2000/43/EC (Racial Equality Directive) states that ‘The European Union rejects theories which attempt to determine the existence of separate human races.’ 2. According to the EU acquis, and specifically Art. 1 of the Council Framework Decision 2008/913/JHA, offences concerning racism and xenophobia are considered to be: (a) publicly inciting to violence or hatred directed against a group of persons or a member of such a group defined by reference to race, colour, religion, descent or national or ethnic origin; (b) the commission of an act referred to in point (a) by public dissemination or distribution of tracts, pictures or other material; (c) publicly condoning, denying or grossly trivialising crimes of genocide, crimes against humanity and war crimes as defined in Articles 6, 7 and 8 of the Statute of the International Criminal Court, directed against a group of persons or a member of such a group defined by reference to race, colour, religion, descent or national or ethnic origin when the conduct is carried out in a manner likely to incite violence or hatred against such a group or a member of such a group; (d) publicly condoning, denying or grossly trivialising the crimes defined in Art. 6 of the Charter of the International Military Tribunal appended to the London Agreement of 8 August 1945, directed against a group of persons or a member of such a group 3. The Council of Europe provides further insight into the understanding of this term at http://www.eycb.coe.int/compass/en/chapter_5/5_4.html M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 461
Rapid Border Intervention Team (RABIT) BG Група за бързо реагиране по границата CS pohraniční jednotka rychlé reakce Definition(s) ES equipos de intervención rápida en frontera A mechanism providing rapid operational assistance for a limited period to a requesting EU Member State facing a situation of urgent and exceptional pressure at points of the external EU borders from large numbers of third-country nationals trying to enter the territory of the EU Member State illegally. ET piirivalve kiirreageerimisrühm Source(s) DE Soforteinsatzteam für Grenzsicherungszwecke EL Ομάδα Tαχείας Eπέμβασης στα Σύνορα (RABIT) EN Rapid Border Intervention Team FI Rajavalvonnan nopean toiminnan joukot (RABIT) FR équipe d’intervention rapide aux frontières (RABIT) GA Foireann Mhear-idirghabhála Teorainneacha HR Tim granične policije za hitnu intervenciju (RABIT) HU gyorsreagálású határvédelmi csapat IT Squadra di intervento rapido alle frontiere LT Pasienio greitojo reagavimo komanda LV ātrās reaģēšanas robežapsardzes vienība Art. 1(1) of Council Regulation (EC) No 863/2007 (Rapid Border Intervention Teams Regulation) Synonym(s) RABIT Related term(s) European Border and Coast Guard Agency (Frontex) Euro Voc Classification 10 European Union| 2811 migration MT Timijiet t’Intervent Rapidu mal-Fruntieri NL snelle-grensinterventieteams PL Zespół Szybkiego Reagowania na Granicy PT Equipa de Intervenção Rápida nas Fronteiras RO Echipe de intervenţie rapidă la frontieră SK rýchle pohraničné zásahové tímy (RABIT) SL skupina za hitro posredovanje na mejah SV snabb gränsinsatsenhet NO beredskapsgruppe for grensekontroll KA საზღვარზე ჩარევის ოპერაციული ჯგუფი UK Прикордонні сили швидкого реагування HY 462 Սահմանային շտապ միջամտության խումբ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B readmission BG обратно приемане CS readmise DE Rückübernahme EL επανεισδοχή EN readmission ES readmisión ET tagasivõtmine FI takaisinotto FR réadmission GA Athligean isteach HR ponovni prihvat HU visszafogadás IT Riammissione LT readmisija LV atpakaļuzņemšana MT riammissjoni NL overname PL readmisja PT Readmissão RO readmisie C D Definition(s) E Act by a State accepting the re-entry of an individual (own national, third-country national or stateless person). F Source(s) Derived by EMN from IOM Glossary on Migration, 2019. Narrower term(s) H readmission agreement Euro Voc Classification 2811 migration I Note(s) J 1. In order to foster the return of migrants who have been ordered to leave the European Union, the EU co-operates actively with the home countries of irregular migrants, in particular through EU readmission agreements (EURA). These set out clear obligations as well as detailed administrative and operational procedures, to facilitate the return and transit of persons who are irregularly residing. They aim at improving cooperation between administrations and can only be used after a return decision has been made in accordance with the procedural guarantees set by the Directive 2008/115/EC (Return Directive) and the relevant EU asylum rules. 2. Some EU readmission agreements include third-country national clauses allowing applications for readmission of persons who do not have the nationality of either of the Parties (including stateless persons) and who transited the territory of one of the Parties. SK readmisia SL ponovni sprejem K L M N O P SV återtagande NO tilbaketakelse (b); tilbaketaking (n) Q KA რეადმისია R UK реадмісія HY G հետընդունում S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 463
readmission agreement BG споразумение за реадмисия CS readmisní dohoda DE Rückübernahmeabkommen EL συμφωνία επανεισδοχής EN readmission agreement ES acuerdo de readmisión ET tagasivõtuleping FI takaisinottosopimus FR accord de réadmission GA comhaontú um athghlactha isteach Definition(s) An agreement between the European Union (EU) and / or an EU Member State with a third country, on the basis of reciprocity, establishing rapid and effective procedures for the identification and safe and orderly return of persons who do not, or no longer, fulfil the conditions for entry to, presence in, or residence in the territories of the third country or one of the EU Member States, and to facilitate the transit of such persons in a spirit of cooperation. Source(s) HR sporazum o ponovnom prihvatu Preamble to EU Readmission Agreements (e.g. EU Readmission Agreement with Serbia) HU visszafogadási egyezmény Broader term(s) IT accordo di riammissione readmission LT readmisijos susitarimas Related term(s) LV atpakaļuzņemšanas nolīgums MT Ftehim ta’ dħul mill-ġdid / ta’ riammissjoni NL overnameovereenkomst PL umowa readmisyjna PT acordo de readmissão RO acord de readmisie SK readmisná dohoda SL sporazum o ponovnem sprejemu / sporazum o vračanju SV återtagandeavtal return mobility partnership Euro Voc Classification 1011 European Union law| 2811 migration Note(s) 1. Readmission agreements concluded between the EU and a third country supersede those of any EU Member State with the same country, although this might not be the case for DK and possibly IE as these EU Member States can choose not to participate in (opt-in to) the relevant EU agreement. 2. For more information, see the website of the European Commission on readmission. NO returavtale KA რეადმისიის შესახებ შეთანხმება UK угода про реадмісію HY 464 հետընդունման համաձայնագիր EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B real risk of suffering serious harm BG реален риск от тежки посегателства C D Definition(s) CS hrozba skutečného nebezpečí vážné újmy DE tatsächliche Gefahr, einen ernsthaften Schaden zu erleiden Risk of serious harm experienced by an applicant for international protection which is considered to be both real and likely to occur. EL πραγματικός κίνδυνος σοβαρής βλάβης Source(s) EN real risk of suffering serious harm Developed by EMN ES riesgo real de sufrir daños graves Broader term(s) ET reaalne risk tõsise ohu tekkimiseks serious harm FI todellinen vaara joutua kärsimään vakavaa haittaa Related term(s) FR risque réel de subir des atteintes graves GA baol iarbhír díobháil thromchúiseach a fhulaingt HR stvaran rizik od trpljenja ozbiljne nepravde HU súlyos sérelem elszenvedésének tényleges veszélye IT rischio effettivo di subire un grave danno LV reāls risks ciest smagu kaitējumu NL reëel risico op het lijden van ernstige schade PL rzeczywiste ryzyko doznania poważnej krzywdy PT risco real de sofrer ofensa grave RO risc real de vătămare gravă SK reálne riziko utrpenia vážneho bezprávia / reálne riziko vážneho bezprávia SL utemeljeno tveganje resne škode SV verklig risk för att lida allvarlig skada NO reell fare for alvorlig skade (b); reell fare for alvorleg skade (n) KA სერიოზული ზიანის მიღების რეალური რისკი H credibility assessment well-founded fear of persecution I EMN Asylum and Migration Classification J Euro Voc Classification K 4.1.2 Subsidiary protection L Note(s) MT riskju veru ta’ dannu serju 1. The likelihood of an applicant for international protection suffering serious harm is assessed in order to provide a standard of proof for assessing eligibility for subsidiary protection. According to Art. 4(4) of the Directive 2011/95/EU (Recast Qualification Directive) on the ‘assessment of facts and circumstances’, earlier serious harm or direct threats are appraised as a ‘serious indication of the applicant’s real risk of suffering serious harm, unless there are good reasons to consider that such persecution or serious harm will not be repeated’. 2. The European Court of Human Rights has ruled in a high number of different cases that there is a violation of Art. 3 of the European Convention on Human Rights (ECHR) ‘if substantial grounds have been shown for believing that the person concerned, if deported, faces a real risk of being subjected to treatment contrary to Art. 3 ECHR’. In light of the Court’s consequent jurisprudence, this standard means that: (a) there is no need for the risk to be very high (no certainty or significant probability requirement); (b) at the same time the risk cannot be a mere possibility (a distant, vague or theoretical alternative). UK реальний ризик зазнати серйозної шкоди HY F G 1011 European Union law| 2811 migration LT realus pavojus patirti didelę žalą E լուրջ վնասի իսկական վտանգ M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 465
receiving Member State BG приемаща държава членка CS přijímající členský stát Definition(s) ES estado miembro receptor In the context of the Dublin Regulation, the (EU) Member State that was designated responsible for the examination of an application of international protection, after having accepted the take back request, must receive the applicant concerned on its territory. ET vastuvõttev liikmesriik Source(s) DE Zielstaat (EU acquis); aufnehmender Mitgliedstaat EL κράτος-μέλος υποδοχής EN receiving Member State HR država članica prihvata Derived by EMN from Art. 31 (2b) of Regulation (EU) No 604/2013 (Dublin III Regulation), and EASO-CdT Terminology Coordination project, based on European Asylum Support Office: EASO Guidance on the Dublin procedure: operational standards and indicators. HU befogadó tagállam Broader term(s) FI vastaanottava jäsenvaltio FR État membre de destination (EU acquis); État membre d’accueil GA Ballstát glacaidh IT receiving Member State LT priimančioji valstybė narė LV saņēmēja dalībvalsts Dublin transfer Related term(s) NL ontvangende lidstaat take back request take charge request transfer notification PL przyjmujące państwo członkowskie EMN Asylum and Migration Classification MT Stat Membru li se jirċievi PT Estado-Membro de acolhimento 6.2.2 Dublin Procedure RO stat membru de primire Euro Voc Classification SK prijímajúci členský štát 1011 European Union law| 2811 migration SL sprejemna država članica SV mottagande medlemsstat NO mottaker-medlemsland (b); mottakar-medlemsland (n) KA ევროკავშირის წევრი მიმღები სახელმწიფო UK приймаюча держава-член HY 466 ընդունող անդամ պետություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B reception BG приемане CS přijímání DE Aufnahme EL υποδοχή EN reception ES acogida ET vastuvõtt FI vastaanotto FR accueil GA glacadh HR prihvat HU befogadás IT accoglienza LT priėmimas LV uzņemšana C In the context of international protection, the full set of measures, facilities and services implemented to ensure that applicants for international protection benefit from their rights laid down in Directive 2013/33/ EU( Recast Reception Conditions Directive), from the moment of making the application until a final decision is taken and to ensure a dignified standard of living and comparable living conditions in all EU Member States. E Source(s) I Derived by EMN from Directive 2013/33/EU (Recast Reception Conditions Directive), and United Nations High Commissioner for Refugees: refugee protection and mixed migration, the 10-point plan in action, Chapter 4: Reception arrangements, 2011. Narrower term(s) PL przyjmowanie accommodation centre reception centre reception conditions reception facilities PT acolhimento EMN Asylum and Migration Classification MT akkoljenza NL opvang RO primire SK prijímanie SL sprejem SV mottagande NO mottak KA მიღება UK прийом HY ընդունելություն D Definition(s) F G H J K L M N 4.4 Reception and Accommodation of Applicants for international protection and other refugees O Euro Voc Classification 2811 migration P Note(s) Q 1. This includes measures and services to meet the basic material and psychosocial needs of all applicants (e.g. accommodation, food, clothing, health care and psychological services) as well as distinguishing between different categories of persons by identifying and addressing their special reception needs and vulnerabilities. 2. Well-functioning reception systems for asylum seekers in the European Union are of central importance for EU Member States and a building block of the Common European Asylum System (CEAS). 3. For more information see: Kegel, Michael: Getting the balance right, strengthening the asylum reception capacity at national and EU levels, 2016. R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 467
reception centre BG приемателен център CS přijímací středisko DE Aufnahmeeinrichtung EL κέντρο υποδοχής EN reception centre ES centro de acogida ET vastuvõtukeskus FI vastaanottokeskus (EN reception centre) FR centre d’accueil (pour demandeurs d’asile) GA ionad fáiltithe HR prihvatilište HU befogadó állomás Definition(s) A location with facilities for receiving, processing and attending to the immediate needs of refugees or asylum seekers as they arrive in a country of asylum. Source(s) UNHCR Master Glossary of Terms Broader term(s) reception facilities Related term(s) accommodation centre EMN Asylum and Migration Classification IT centro di accoglienza per richiedenti asilo 4.4 Reception and Accommodation of Applicants for international protection and other refugees LT priėmimo centras Euro Voc Classification LV uzņemšanas centrs MT Ċentru ta’ akkoljenza (għal min jitlob l-ażil) NL asielzoekerscentrum (NL); opvangcentrum (BE) PL ośrodek recepcyjny PT centro de acolhimento 2811 migration Note(s) For more information on categories of reception centres available in EU Member States, see EMN: the Organisation of Reception Facilities for Asylum Seekers in different Member States, 2013. RO centru de primire SK prijímacie zariadenie (EU acquis); záchytný tábor SL sprejemni center SV mottagningsenhet NO transittmottak KA მიმღები ცენტრი UK центр прийому HY 468 ընդունելության կենտրոն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B reception conditions BG условия на приемане CS podmínky přijetí C D Definition(s) DE Aufnahmebedingungen The full set of measures that EU Member States grant to applicants for international protection. E EL συνθήκες υποδοχής Source(s) F EN reception conditions ES condiciones de acogida ET vastuvõtutingimused FI vastaanotto-olosuhteet FR conditions d’accueil GA dálaí mpl glactha HR uvjeti prihvata HU befogadási feltételek IT condizioni di accoglienza LT priėmimo sąlygos LV uzņemšanas apstākļi (EU acquis); uzņemšanas nosacījumi Art. 2(f) of Directive 2013/33/EU (Recast Reception Conditions Directive) G Narrower term(s) H material reception conditions EMN Asylum and Migration Classification 4.4 Reception and Accommodation of Applicants for international protection and other refugees I Euro Voc Classification J 2811 migration K Note(s) L For more information on reception conditions in the EU, see EMN: the Organisation of Reception Facilities for Asylum Seekers in different Member States , 2013. MT Kondizzjonijiet tal-akkoljenza M NL opvangvoorzieningen N PL warunki przyjmowania PT condições de acolhimento RO condiții de primire / condiţii de recepţie O SK prijímacie podmienky (EU acquis); podmienky prijímania P SL sprejemni pogoji Q SV mottagningsvillkor NO mottaksforhold (b); mottakstilhøve (n) R KA მიღების პირობები UK умови прийому HY S ընդունելության պայմաններ T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 469
reception facilities BG приемни съоръжения CS přijímací zařízení DE Aufnahmeeinrichtungen EL εγκαταστάσεις υποδοχής EN reception facilities ES centros de acogida ET vastuvõtu majutusasutused FI vastaanottotilat FR structures d’accueil GA áiseanna fáiltithe HR objekti prihvatilišta HU befogadó létesítmények IT struttura di accoglienza Definition(s) All forms of premises used for the housing of applicants for international protection and other categories of migrants and refugees. Source(s) Developed by EMN Narrower term(s) accommodation centre reception centre EMN Asylum and Migration Classification 4.4 Reception and Accommodation of Applicants for international protection and other refugees Euro Voc Classification 2811 migration LT priėmimo centrai LV uzņemšanas telpas MT Faċilitajiet ta’ akkoljenza NL opvangfaciliteiten Note(s) For more information on categories of reception facilties available in EU Member States, see EMN: The Organisation of Reception Facilities for Asylum Seekers in different Member States, 2013. PL ośrodki przyjmowania PT instalações de acolhimento RO facilități de primire SK prijímacie zariadenia (EU acquis) SL sprejemni objekti SV anläggningsboende NO asylmottak KA მიმღები დაწესებულებები UK заклади прийому HY 470 ընդունելության կառույցներ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B recognition of foreign qualifications BG признаване на чуждестранни квалификации CS uznávání zahraničních kvalifikací DE Anerkennung ausländischer Qualifikationen EL αναγνώριση τίτλων σπουδών της αλλοδαπής (EL); αναγνώριση τίτλων σπουδών εξωτερικού (CY) EN recognition of foreign qualifications ES reconocimiento de cualificaciones obtenidas en el extranjero ET välisriigi kvalifikatsiooni tunnustamine FI ulkomaisten tutkintojen vastaavuuden tunnustaminen FR reconnaissance des qualifications acquises à l’étranger C D Definition(s) E A formal acknowledgement by a competent authority of the validity of a foreign qualification with a view to access to educational and / or employment activities. F Source(s) Derived by EMN from the definition of ‘recognition’ in Art.1 of the Council of Europe Convention on the Recognition of Qualifications concerning Higher Education in the European Region G H EMN Asylum and Migration Classification I 8.2 Access to employment| 8.3 Access to education Euro Voc Classification J 2811 migration| 3206 education GA aithint cáilíochtaí iasachta K HR priznavanje inozemnih kvalifikacija L HU külföldi képesítések elismerése IT riconoscimento della qualifica estera M LT užsienyje įgytų kvalifikacijų pripažinimas LV ārvalstīs iegūtu kvalifikāciju atzīšana N MT Rikonoxximent ta’ kwalifiki barranin NL erkenning van buitenlandse getuigschriften PL uznanie kwalifikacji (zawodowych) cudzoziemca O PT reconhecimento de qualificações obtidas no estrangeiro P RO recunoaşterea calificărilor din străinătate Q SK uznávanie odborných kvalifikácií zo zahraničia / uznávanie dokladov o vzdelaní zo zahraničia R SL priznavanje tujih kvalifikacij SV erkännande av utländska kvalifikationer S NO godkjenning av utenlandske kvalifikasjoner (b); godkjenning av utanlandske kvalifikasjonar (n) T KA უცხოური კვალიფიკაციების აღიარება UK визнання іноземних кваліфікацій HY U օտարերկրյա որակավորումների ճանաչում V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 471
recognition rate (in procedures for international protection) BG ниво на признаване LV atzīšanas rādītājs CS míra kladných rozhodnutí o mezinárodní ochraně MT Rata ta’ rikonoxximent (fil-proċeduri għall-protezzjoni internazzjonali) DE Anerkennungsrate (in Verfahren auf internationalen Schutz) NL erkenningsgraad / beschermingsgraad EL ποσοστό αναγνώρισης (στις διαδικασίας διεθνούς προστασίας) PL poziom uznawalności (w procedurze udzielenia ochrony międzynarodowej) EN recognition rate (in procedures for international protection) PT taxa de reconhecimento (no procedimento de concessão e retirada do estatuto de proteção internacional) ES tasa de reconocimiento (en procedimientos de protección internacional) ET heakskiitmise määr (rahvusvahelise kaitse menetlustes) FI myönteisten päätösten osuus (kansainvälisen suojelun menettelyssä) RO rată de recunoaștere (în procedurile de examinare a cererii de azil) SK miera uznania / miera uznaných žiadostí (v konaniach o medzinárodnej ochrane) SL odstotek priznanih statusov mednarodne zaščite FR taux de reconnaissance (dans les procédures de demande de la protection internationale) SV andelen beviljade ansökningar om internationellt skydd GA ráta aitheantais (i gcás nósanna imeachta maidir le cosaint idirnáisiúnta) NO andel positive vedtak (etter søknad om internasjonal beskyttelse) (b); del av vedtaka som er positive (etter søknad om internasjonalt vern) (n) HR stopa priznavanja / odobravanja (međunarodne zaštite) HU elsimerési arány (nemzetközi védelemre vonatkozó eljárások során) IT tasso di riconoscimento (nelle procedure di protezione internazionale) KA აღიარების მაჩვენებელი (საერთაშორისო დაცვის პროცედურებში) UK відсоток визнання (у процедурах міжнародного захисту) HY LT teigiamų sprendimų suteikti prieglobstį procentas 472 EMN ASYLUM AND MIGRATION GLOSSARY 10.0 ճանաչման տոկոս (միջազգային պաշտպանության ընթացակարգում)
A B C D Definition(s) E The number of positive decisions on applications for international protection as a proportion of the total number of decisions issued for each stage of the procedure (i.e. first instance and final on appeal) in the reference period under review. F G Source(s) Derived by EMN from EUAA Annual Asylum Report and Eurostat ‘Statistics Explained’ website H Synonym(s) I asylum recognition rate international protection recognition rate J EMN Asylum and Migration Classification 4. International Protection and other Types of Protection| 6.2 Procedure for international protection/Refugee status determination K L Euro Voc Classification 1011 European Union law| 2811 migration M Note(s) N 1. Positive decisions include EU-regulated international protection status (refugee status and subsidiary protection status) and may include non-EU harmonised protection which is understood as authorisation to stay for humanitarian reasons under national law. 2. The total number of decisions (positive decisions and rejections) includes all formal decisions such as e.g. implicit and explicit withdrawals, Dublin cases or closed cases for administrative reasons (e.g. the applicant has died). 3. Eurostat defines the (asylum) recognition rate as “the share of positive decisions in the total number of asylum decisions for each stage of the asylum procedure (i.e. first instance and final on appeal)”. The total number of decisions consists of the sum of positive and negative decisions. Calculation of the overall recognition rate for all stages of the asylum procedure cannot be made due to lacking information linking the outcomes at first instance and final on appeal for each person concerned. As some of the applicants rejected at the first instance and who lodged an appeal in the same year receive a final negative decision, it would lead to multiplication of some rejected applicants and would cause underestimation of the overall recognition rate. Final decisions on appeal statistics broken down by the year of the first instance rejection would be required to avoid this multiplication. O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 473
re-entry BG повторно влизане CS opětovný vstup DE Wiedereinreise EL επανείσοδος EN re-entry ES re-entrada ET taassisenemine, korduv sisenemine FI maahanpaluu FR nouvelle entrée GA athiontráil Definition(s) In the context of Directive 2016/801/EU (Recast Researcher’s Directive), the return of a researcher or a student from a second EU Member State in which they have been residing for up to 180 days (in respect of the conditions for mobility permitted by this Directive) to the EU Member State in which they were originally authorised to stay following the withdrawal or expiration of the period of mobility by the second EU Member State. Source(s) HR ponovni ulazak Derived by EMN on the basis of Recital 50 and Art. 28 of Directive 2016/801/EU (Recast Researcher’s Directive) HU újbóli belépés EMN Asylum and Migration Classification IT Reingresso 3.3 Migration for Study and Research LT pakartotinis atvykimas Euro Voc Classification LV atkārtota ieceļošana MT Dħul lura NL het opnieuw toelaten (op het grondgebied van de vreemdeling PL ponowny wjazd; ponowne przekroczenie granicy PT reentrada RO reintrarea 2811 migration| 3206 education Note(s) 1. Where re-entry is authorised, the first EU Member State should issue the researcher or student with a document allowing re-entry to its territory. 2. When re-entry to the first EU Member State is not authorised, it is possible for the second EU Member State to return the researcher or the student to a third country in accordance with Directive 2008/115/EC (Return Directive) whether in voluntary or enforced compliance with an obligation to return. SK opätovný vstup SL ponovni vstop SV återresa NO retur til et EU-/EFTA-land (b); retur til eit EU-/ EFTA-land (n) KA ხელახალი შესვლა UK повторний в’їзд HY 474 կրկին մուտք գործել EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B reflection period BG период за размисъл CS tzv. doba na rozmyšlení DE Bedenkzeit EL περίοδος περίσκεψης EN reflection period ES período de reflexión ET järelemõtlemisaeg FI harkinta-aika FR délai de réflexion GA tréimhse mhachnaimh HR period razmišljanja HU mérlegelési idő / gondolkodási idő IT Periodo di riflessione LT apsisprendimo laikotarpis LV nogaidīšanas periods MT Perjodu ta’ riflessjoni NL bedenktijd C D Definition(s) A period of time determined according to national law granted to third-country nationals officially identified as victims of trafficking in human beings allowing the victim to recover and escape the influence of the perpetrators of the offences so that they can take an informed decision as to whether (or not) to cooperate with the competent authorities. E Source(s) H Derived by EMN from Art. 6(1) of Council Directive 2004/81/EC (Trafficking in Human Beings Directive) G I Broader term(s) J identified victim of trafficking in human beings Euro Voc Classification 2811 migration K Note(s) L This term refers specifically to the context of trafficking in human beings, though ‘reflection period’ can be used in other national contexts with a less specific meaning. PL czas na zastanowienie się M N PT período de reflexão RO perioadă de gândire O SK lehota na rozmyslenie SL obdobje za razmislek P SV betänketid NO refleksjonsperiode Q KA მოსაფიქრებელი ვადა R UK час на обмірковування HY F դիտարկման ժամկետ S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 475
refugee BG бежанец CS uprchlík DE Flüchtling / Geflüchteter EL πρόσφυγας EN refugee ES refugiado ET pagulane FI pakolainen FR réfugié GA dídeanaí HR izbjeglica HU menekült IT rifugiato LT pabėgėlis LV bēglis MT Rifuġjat(a) NL vluchteling PL uchodźca PT refugiado RO refugiat SK utečenec (EU acquis); azylant SL begunec SV flykting NO flyktning KA ლტოლვილი UK біженець HY փախստական Definition(s) In the global context, either a person who, owing to a well-founded fear of persecution for reasons of race, religion, nationality, political opinion or membership of a particular social group, is outside the country of nationality and is unable or, owing to such fear, is unwilling to avail themselves of the protection of that country, or a stateless person, who, being outside of the country of former habitual residence for the same reasons as mentioned before, is unable or, owing to such fear, unwilling to return to it. In the EU context, either a third-country national who, owing to a well-founded fear of persecution for reasons of race, religion, nationality, political opinion or membership of a particular social group, is outside the country of nationality and is unabble or, owing to such fear, is unwilling to avail themselves of the protection of that country, or a stateless person, who, being outside of the country of former habitual residence for the same reasons as mentioned before, is unable or, owing to such fear, unwilling to return to it, and to whom Art.12 (exclusion) of Directive 2011/95/EU (Recast Qualification Directive) does not apply Source(s) Global context: Art. 1A of the Geneva Refugee Convention and Protocol EU context: Art. 2(d) of Directive 2011/95/EU (Recast Qualification Directive) Broader term(s) forced migrant Narrower term(s) Convention refugee prima facie refugee resettled refugee Related term(s) applicant for international protection asylum seeker exclusion clause EMN Asylum and Migration Classification 4.1.1 Refugee protection Euro Voc Classification 1011 European Union law| 1231 international law| 2811 migration Note(s) Whereas the exclusion clauses are an integral part of the refugee definition of Directive 2011/95/EU (Recast Qualification Directive), the Geneva Refugee Convention and Protocol refers to the exclusion clauses in its Articles 1D, 1E and 1F (see also the definition of ‹exclusion clause›). 476 EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B refugee in orbit BG no translation CS refugee in orbit (no translation) DE refugee in orbit (no usual translation) EL πρόσφυγας σε τροχιά EN refugee in orbit ES refugiados en órbita ET ringlev pagulane (no usual translation) FI kiertävä pakolainen (not in general use) FR réfugié en orbite C D Definition(s) A refugee who, although not returned directly to a country where they may be persecuted, is denied asylum or unable to find a State willing to examine their request, and are shuttled from one country to another in a constant search for asylum. Source(s) UNHCR International Thesaurus of Refugee Terminology Related term(s) E F G H GA dídeanaí ag fithisiú de facto refugee postponement of removal I HR no usual translation EMN Asylum and Migration Classification J Euro Voc Classification K HU keringő menekült / bolyongó menekült IT rifugiato vagante LT pabėgėlis orbitoje 4.1.1 Refugee protection 2811 migration L LV pastāvīgos patvēruma meklējumos esošs bēglis MT Rifuġjat(a) f’orbita / f’limbu M NL vluchteling in orbit PL uchodźca na orbicie / refugee in orbit N PT refugiado em órbita RO refugiat pe orbită O SK utečenec v pohybe / refugee in orbit SL tavajoči begunec P SV flykting på väg / flykting som slussas mellan länder NO videresendt flyktning (b); vidaresend flyktning (n) Q KA სხვადასხვა ქვეყანაში თავშესაფრის ძიებაში მყოფი ლტოლვილი R UK біженець у русі HY S շրջիկ փախստական T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 477
refugee in transit BG no translation CS refugee in transit (no translation) DE refugee in transit (no usual translation) EL πρόσφυγας σε ζώνη διέλευσης EN refugee in transit ES refugiado en tránsito ET transiidipagulane (no usual translation) FI kauttakulkupakolainen FR réfugié en transit GA dídeanaí idirthurais HR izbjeglice u tranzitu HU no usual translation IT rifugiato in transito Definition(s) A refugee who is temporarily admitted in the territory of a State under the condition that they are resettled elsewhere. Source(s) UNHCR International Thesaurus of Refugee Terminology Related term(s) resettled refugee resettlement EMN Asylum and Migration Classification 4.1.1 Refugee protection| 5. Relocation, Resettlement and Humanitarian Admission Euro Voc Classification 2811 migration LT tranzitinis pabėgėlis LV tranzītbēglis MT Rifuġjat(a) fi tranżitu NL vluchteling in transit Note(s) 1. This term is currently little used in the EU. 2. The term should not be confused with refugees who stay in the transit area of an airport. PL uchodźca w tranzycie PT refugiado em trânsito RO refugiat în tranzit / refugiat aflat în tranzit SK utečenec v tranzite / tranzitujúci utečenec SL begunec v tranzitu SV transitflykting NO flyktning i transitt KA ტრანზიტული ლტოლვილი UK транзитний біженець HY 478 տարանցող փախստական EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B refugee law BG бежанско право CS uprchlické právo DE Flüchtlingsrecht EL Δίκαιο Προσφύγων/ Προσφυγικό Δίκαιο EN refugee law ES legislación de asilo ET varjupaigaõigus FI pakolaisoikeus FR droit des réfugiés GA dlíthe um dhídeanaithe HR izbjegličko pravo HU menekültjog IT legislazione sull’asilo LT pabėgėlių teisė LV bēgļu tiesības MT Liġi / Att dwar ir-rifuġjati NL vluchtelingenrecht PL prawo uchodźcze PT legislação de asilo e proteção internacional C D Definition(s) The body of customary international and European Union (EU) law and instruments that establish standards for refugee protection. Source(s) Derived by EMN from UNHCR Master Glossary of Terms Synonym(s) F G H international refugee law Narrower term(s) I Geneva Refugee Convention and Protocol Related term(s) J human rights law EMN Asylum and Migration Classification K 4.1.1 Refugee protection Euro Voc Classification L 1231 international law| 2811 migration M Note(s) The cornerstone of refugee law is the Geneva Refugee Convention and Protocol. RO legislaţia cu privire la refugiaţi N O SK utečenecké právo SL begunsko pravo P SV flyktingrätt NO flyktningrett Q KA ლტოლვილთა სამართალი R UK біженське право HY E Փախստականների մասին Օրենք S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 479
refugee status BG статут на бежанец CS postavení uprchlíka Definition(s) DE Flüchtlingsstatus The recognition by an EU Member State of a thirdcountry national or stateless person as a refugee. EL καθεστώς πρόσφυγα Source(s) EN refugee status ES estatuto de refugiado ET pagulasseisund FI pakolaisasema FR statut de réfugié GA stádas dídeanaí HR status izbjeglice HU menekült státusz IT status di rifugiato LT pabėgėlio statusas LV bēgļa statuss MT Status ta’ rifuġjat(a) Art. 2(e) of Directive 2011/95/EU (Recast Qualification Directive) Broader term(s) international protection Related term(s) beneficiary of international protection Convention refugee withdrawal of refugee status subsidiary protection status EMN Asylum and Migration Classification 4.1.1 Refugee protection Euro Voc Classification 1231 international law| 2811 migration NL vluchtelingenstatus PL status uchodźcy PT estatuto de refugiado RO statutul de refugiat SK postavenie utečenca (EU acquis); status utečenca / štatút utečenca SL status begunca SV flyktingstatus NO flyktningstatus KA ლტოლვილის სტატუსი UK статус біженця HY 480 փախստականի կարգավիճակ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B refugee sur place BG бежанец на място / бежанец sur place CS uprchlík na místě / uprchlík sur place DE Flüchtling sur place; objektiver Nachfluchtgrund; subjektiver Nachfluchtgrund EL επί τόπου πρόσφυγας EN refugee sur place ES refugiado sobrevenido ET sur place pagulane FI sur place -pakolainen FR réfugié sur place C In the global context, a person who was not a refugee when they left their country of origin, but who becomes a refugee, that is, acquires a wellfounded fear of persecution, at a later date, owing to intervening events. In the EU context, a person granted refugee status based on international protection needs which arose sur place, i.e. on account of events which took place after they left their country of origin. E Source(s) I HU sur place menekült Global context: Derived by EMN from UNCHR Master Glossary of Terms EU context: Derived by EMN from Art. 5 of Directive 2011/95/EU (Recast Qualification Directive) IT rifugiato sur place Synonym(s) GA dídeanaí sur place HR izbjeglica sur place LT pabėgėlis sur place LV bēglis sur place MT Rifuġjat(a) sur place NL vluchteling sur place; réfugié sur place (NL) PL uchodźca sur place / uchodźca na miejscu PT refugiado sur place RO refugiat sur place SK utečenec sur place / utečenec na mieste D Definition(s) SV sur place-flykting KA სურ პლას (sur place/”ადგილზე”) ლტოლვილი UK біженець «на місці» / біженець sur place HY «տեղում» փախստական դարձած G H J K objective grounds for seeking asylum occurring after the applicant’s departure from their country of origin subjective grounds for seeking asylum based on the applicant’s activities in their host country EMN Asylum and Migration Classification L M N 4.1.1 Refugee protection Euro Voc Classification O 1011 European Union law| 1231 international law| 2811 migration P SL begunec sur place NO sur place-flyktning F Note(s) Refugees sur place may owe their fear of persecution usually either ƒ due to a change of situation in their country of origin (e.g. coup d’état, change of government, introduction or intensification of repressive or persecutory policies or outbreak of armed conflict) or ƒ based on bona fide political activities (e.g. expressing political views) undertaken in the country of residence or refuge. Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 481
refusal of entry BG отказ за влизане CS odmítnutí vstupu DE Verweigerung der Einreise (EU acquis); Einreiseverbot (DE) EL απαγόρευση εισόδου EN refusal of entry ES denegación de entrada ET sisenemiskeeld / isiku riiki mittelubamine FI käännyttäminen / pääsyn epääminen FR refus d’entrée GA náisiúnaigh tríú tír ar diúltaíodh iontráil dóibh Definition(s) In the global context, refusal of entry of a person who does not fulfil all the entry conditions laid down in the national legislation of the country for which entry is requested. In the EU context, refusal of entry of a third-country national at the external EU border because they do not fulfil all the entry conditions laid down in Art. 6(1) of Regulation (EU) 2016/399 (Schengen Border Code) and do not belong to the categories of persons referred to in Art.6 (5) of that Regulation. Source(s) IT respingimento (rifiuto di ingresso) Global context: Developed by EMN EU context: Derived by EMN from the definition for ‘thirdcountry nationals refused entry’ in Art. 2(q) of Regulation (EC) No 862/2007 (Migration Statistics Regulation) LT neįleidimas Related term(s) HR odbijanje ulaska HU beléptetés megtagadása LV ieceļošanas atteikums MT Dħul miċħud / Tbarrija NL toegangsweigering PL odmowa wjazdu PT recusa de entrada a nacional de estado terceiro RO refuzarea intrării SK odopretie vstupu SL zavrnitev vstopa SV nekad inresa border control external EU border internal EU border irregular entry legal entry EMN Asylum and Migration Classification 6.1 Entry Conditions and Procedures Euro Voc Classification 2811 migration NO innreisenekt KA უარი შესვლაზე UK відмова у в’їзді HY 482 մուտքի արգելք EMN ASYLUM AND MIGRATION GLOSSARY 10.0
regional development and protection programme (RDPP) BG регионална програма за развитие и закрила (РПРЗ) DE regionales Entwicklungs- und Schutzprogramm EL Πρόγραμμα Περιφερειακής Ανάπτυξης και Προστασίας (RDPP) EN regional development and protection programme (RDPP) ES Programa regional de desarrollo y protección C D International protection initiative set up by the European Union and its Member States to enhance the capacity of third countries in the regions from which many refugees originate, or through which they pass in transit with the aim to improve refugee protection through durable solutions, namely return, local integration and resettlement. E Source(s) H European Commission: Communication on Regional Protection Programmes, COM(2005) 388 final ET piirkondlik arengu- ja kaitseprogramm FI alueellinen kehitys- ja suojeluohjelma HR Program regionalnog razvoja i zaštite K Related term(s) HU regionális fejlesztési és védelmi program IT programma di protezione e sviluppo regionale (PPSR) durable solutions resettlement LT regioninė vystymosi ir apsaugos programa EMN Asylum and Migration Classification LV reģionālā attīstības un aizsardzības programma L M 4.1 International protection| 15.1 EU External dimension of migration and mobility MT Programm għall-protezzjoni u l-iżvilupp reġjonali (PPiŻR) Euro Voc Classification NL Regionaal ontwikkelings- en beschermingsprogramma PL program ochrony i rozwoju regionalnego PT Programa Regional de Desenvolvimento e Proteção (PRDP) RO program regional de dezvoltare și protecție (PRDP) SK regionálny program rozvoja a ochrany (RDPP) SL regionalni program za razvoj in zaščito SV regionalt utvecklings- och skyddsprogram NO Regionalt program for utvikling og beskyttelse (RDPP) KA განვითარებისა და დაცვის რეგიონული პროგრამა (RDPP) UK регіональна програма розвитку та захисту (РПРЗ) G J RDPP RPP regional protection programme (RPP) GA clár um fhorbairt agus um chosaint réigiúnach F I Synonym(s) FR programme régional de développement et de protection զարգացման եւ պաշտպանության տարածաշրջանային ծրագիր B Definition(s) CS regionální program rozvoje a ochrany HY A N 04 Politics| 1011 European Union law| 2811 migration O Note(s) P 1. The 2005 Communication on Regional Protection Programmes’ (COM (2005) 388 final) brought forward regional protection programmes (RPP) as a new EU approach to the international protection regime. The Programmes were developed by the European Commission in close collaboration with EU Member States, the United Nations High Commissioner for Refugees (UNHCR), and in partnership with the countries of origin, transit and first asylum. The programmes involve practical actions related to improving general protection in the host country, establishing an effective procedure for determining refugee status, building capacity and training on protection issues for those working with refugees, support measures benefiting the local community hosting refugees. 2. The first two Regional Protection Programmes targeted Eastern Europe (in particular Belarus, the Republic of Moldova and Ukraine) as a region of transit and the African Great Lakes Region (particularly Tanzania) as a region of origin. In 2010, the EU Commission applied the Regional Protection Programme concept to two new regions: the Horn of Africa (including Kenya, Yemen and Djibouti) and eastern North Africa (Egypt, Libya and Tunisia). In response to the Syria refugee crisis the EU Commission established in 2013 the regional development and protection programme (RDPP) in the Middle East and extended the programme to development measures. 3. Under the European Agenda on Migration the priority regions for resettlement include North Africa, the Horn of Africa and the Middle East, focusing on the countries where the RDPPs are implemented. RDPPs also include a resettlement element. 4. For more information see the description of Regional Protection Programmes on the Website of DG Migration and Home Affairs, External aspects. Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 483
regularisation BG узаконяване CS regularizace / legalizace pobytu DE Legalisierung / Regularisierung EL νομιμοποίηση EN regularisation ES regularización ET seadustamine FI laillistaminen FR régularisation GA tabhairt chun rialtachta HR reguliranje statusa HU legalizálás IT regolarizzazione Definition(s) In the EU context, state procedure by which illegally staying third-country nationals are awarded a legal status. Source(s) ICMPD: REGINE: Regularisations in Europe, 2009 Synonym(s) amnesty (in the context of migration) legalisation EMN Asylum and Migration Classification 8.1 Right of residence, authorisation of stay/long-term visa, / residence permits Euro Voc Classification 1011 European Union law| 2811 migration LT reguliarizacija LV legalizācija MT Regolarizzazzjoni NL regularisatie PL regularyzacja PT regularização RO regularizare / legalizare SK legalizácia / regularizácia SL regularizacija / ureditev statusa (tujcev) SV regularisering NO regularisering KA რეგულარიზაცია UK регуляризація HY 484 կանոնականացում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B regulated profession BG регламентирана професия C D Definition(s) CS regulované povolání ES profesión regulada A professional activity or group of professional activities, access to which, the pursuit of which, or one of the modes of pursuit of which is subject, directly or indirectly, by virtue of legislative, regulatory or administrative provisions to the possession of specific professional qualifications. ET reguleeritud kutseala Source(s) DE reglementierter Beruf EL νομοθετικά κατοχυρωμένο επάγγελμα EN regulated profession FR profession réglementée GA profesión regulada HU szabályozott szakma IT professione regolamentata EMN Asylum and Migration Classification J K Euro Voc Classification LV reglamentētā profesija MT professjoni regolata NL gereglementeerd beroep PL zawód regulowany PT profissão regulada RO profesie reglementată SK regulované povolanie SL reguliran poklic SV reglerat yrke NO et lovregulert yrke (b); eit lovregulert yrke (n) KA რეგულირებადი პროფესია UK регульована професія HY I 3.1 Migration for Economic Purposes| 8.2 Access to employment LT reglamentuojama profesija կանոնակարգված աշխատանք (մասնագիտություն) G Related term(s) recognition of foreign qualifications HR regulirana profesija F H Art. 3(1)a of Directive 2005/36/EC (Professional Qualifications Directive) FI säännelty ammatti E 2811 migration| 4406 employment L Note(s) M 1. Directive 2005/36/EC applies to all nationals of an EU Member State wishing to pursue a regulated profession in an EU Member State. Third-country nationals benefit from equal treatment with regard to access to regulated professions, upon recognition of their qualifications according to the rules and procedures set by the EU Member State where they wish to access a regulated profession. 2. Art 2(i) of Council Directive 2009/50/EC on the conditions of entry and residence of third-country nationals for the purposes of highly qualified employment makes also a reference to ‘regulated profession’ as defined in Article 3(1)(a) of Directive 2005/36/EC. 3. In general, the definition of what constitutes regulated and non-regulated professions differ. Binding recognition procedures generally apply to regulated professions. With respect to non-regulated professions, the recognition of qualifications is not a general requirement. There is a plethora of methods that have been developed for both regulated and non-regulated professions. Systems include regulation by national and/or provincial professional bodies (as in Australia and Canada), employer-based recognition processes (as in SE), coordination by one public authority in charge of regulated professions (as in DK) or automatic recognition, which is based on the European Qualifications Framework/ Professional Qualifications Directive and apply to EU nationals, but in most cases not to third-country nationals. 4. The European Commission established a Regulations Professions Database which defines regulated profession as “a profession where access and exercise is subject to the possession of a specific professional qualification.›This database contains lists of regulated professions in the EU Member States, CH and UK. N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 485
reintegration BG реинтеграция CS reintegrace DE Reintegration EL επανένταξη EN reintegration ES reintegración ET taaslõimumine FI uudelleenkotoutuminen FR réintégration; réinsertion (FR) GA athimeascadh HR reintegracija HU reintegráció IT reintegrazione Definition(s) Re-inclusion or re-incorporation of a person into a group or a process, e.g. of a migrant into the society of their country of return. Source(s) Developd by EMN Related term(s) integration return EMN Asylum and Migration Classification 9. Integration Euro Voc Classification 2811 migration LT reintegracija LV reintegrācija MT Riintegrazzjoni NL reïntegratie PL reintegracja PT reintegração RO reintegrare SK reintegrácia SL reintegracija / ponovno vključevanje SV återintegrering NO reintegrering KA რეინტეგრაცია UK реінтеграція HY 486 վերաինտեգրում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B reintegration assistance BG подпомагане на реинтеграцията CS reintegrační asistence DE Reintegrationshilfe / Wiedereingliederungshilfe EL βοήθεια για την επανένταξη EN reintegration assistance ES Ayuda a la reintegración ET reintegratsioonitoetus FI uudelleenkotoutumistuki FR aide à la réintégration (BE, LU); aide à la réinsertion (FR) GA cúnamh ath-imeasctha HR potpora u reintegraciji HU reintegrációs támogatás IT assistenza alla reintegrazione LT reintegracijos pagalba LV reintegrācijas palīdzība MT Għajnuna / Assistenza għar-riintegrazzjoni NL reïntegratiesteun PL pomoc reintegracyjna PT assistência à reintegração C D Definition(s) Support either cash, in kind or combined, provided by a host country to a returnee, with the aim of helping the returnee to lead an independent life after return. Source(s) Developed by the EMN REG E F G Broader term(s) H assisted voluntary return Related term(s) reintegration assisted voluntary return and reintegration programme (AVRR) EMN Asylum and Migration Classification I J K 9.1 Integration measures Euro Voc Classification 2811 migration L Note(s) M The reintegration package often consists of in cash and/or in-kind assistance (including counselling, referral and assistance). The assistance can be provided before return (e.g. preparatory vocational training in the host country in view of a return) or afterwards. N RO asistență pentru reintegrare O SK reintegračná pomoc / pomoc pri reintegrácii / reintegračná asistencia P SL pomoč pri reintegraciji / pomoč pri ponovnem vključevanju Q SV återetableringsstöd R NO hjelp til reintegrering KA რეინტეგრაციის ხელშეწყობა S UK допомога в реінтеграції HY վերաինտեգրման աջակցություն T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 487
rejected applicant for international protection BG отхвърлен кандидат за международна закрила CS žadatel o mezinárodní ochranu, jehož žádost byla zamítnuta DE abgelehnter Antragsteller auf internationalen Schutz EL απορριφθείς αιτών διεθνή προστασία (EL); απορριφθείς αιτητής (CY) EN rejected applicant for international protection ES solicitante al que se le ha denegado la protección internacional ET tagasilükatud rahvusvahelise kaitse taotleja FI kielteisen päätöksen saanut kansainvälisen suojelun hakija FR demandeur de protection internationale débouté; débouté (LU); débouté du droit d’asile (FR); personne déboutée (LU) GA iarratasóir ar diúltaíodh cosaint idirnáisiúnta dó HR odbijeni tražitelj za međunarodnu zaštitu HU elutasított menedékkérő IT richiedente protezione internazionale respinto LT asmuo, kuriam tarptautinė apsauga nesuteikta (EU acquis); asmuo, kuriam prieglobstis nesuteiktas LV persona, kurai atteikts piešķirt starptautisko aizsardzību MT Applikant(a) għall-protezzjoni internazzjonali respint(a) / miċħud(a) NL afgewezen verzoeker om internationale bescherming PL osoba, której wniosek o objęcie ochroną międzynardową został odrzucony PT requerente a quem é recusada a proteção internacional RO solicitant al protecţiei internaţionale respins / a cărui cerere a fost respinsă SK neúspešný žiadateľ o medzinárodnú ochranu / neúspešný žiadateľ o udelenie medzinárodnej ochrany / žiadateľ o medzinárodnú ochranu, ktorému bola žiadosť zamietnutá / žiadateľ o udelenie medzinárodnej ochrany, ktorému bola žiadosť zamietnutá SL zavrnjeni prosilec za mednarodno zaščito SV person som omfattas av beslut om avslag på ansökan om internationellt skydd NO person med avslag på søknad om internasjonal beskyttelse (b); person med avslag på søknad om internasjonalt vern (n) KA განმცხადებელი, რომელსაც უარი ეთქვა საერთაშორისო დაცვის მინიჭებაზე UK заявник, якому було відмовлено в наданні міжнародного захисту HY 488 EMN ASYLUM AND MIGRATION GLOSSARY 10.0 միջազգային պաշտպանության մերժված հայցող
A B C D Definition(s) E A person covered by a first instance decision rejecting an application for international protection, including decisions considering applications as inadmissible or as unfounded and decisions under priority and accelerated procedures, taken by administrative or judicial bodies during the reference period. F G Source(s) H Art. 4(2a) of Regulation (EC) No 862/2007 (Migration Statistics Regulation) I Synonym(s) failed applicant of international protection failed asylum seeker rejected applicant J K Broader term(s) applicant for international protection asylum seeker L Related term(s) M final decision rejecting an application for international protection N EMN Asylum and Migration Classification 4.1 International protection| 6.2 Procedure for international protection/Refugee status determination O Euro Voc Classification P 1011 European Union law| 2811 migration Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 489
relocation BG преместване/ релокация CS relokace DE Umsiedlung (EU-acquis); Umverteilung EL μετεγκατάσταση EN relocation ES reubicación ET ümberpaigutamine FI sisäinen siirto FR relocalisation GA athshocrú HR premještanje HU relokáció IT ricollocazione LT perkėlimas LV pārcelšana MT rilokazzjoni NL herplaatsing PL relokacja PT recolocação RO relocare SK premiestnenie (EU acquis); relokácia SL premestitev SV omplacering NO relokalisering Definition(s) a) In the general EU-context, the transfer of persons having a status defined by the Geneva Refugee Convention and Protocol or subsidiary protection within the meaning of Directive 2011/95/ EU (Recast Qualification Directive) from the EU Member State which granted them international protection to another EU Member State where they will be granted similar protection, and of persons having applied for international protection from the EU Member State which is responsible for examining their application to another EU Member State where their applications for international protection will be examined. b) In the context of the EU emergency relocation programme, the transfer of persons in clear need of international protection, as defined in Council Decisions 2015/1601 and 2016/1754, having applied for international protection from the EU Member State, CH or NO which is responsible for examining their application to another EU Member State, CH or NO where their application for international protection will be examined. Source(s) a) General EU context: DG MIgration and Home Affairs: Website on Relocation B) Context of EU emergency relocation programme: Council Decision (EU) 2015/1601 and Council Decision (EU) 2016/1754 Synonym(s) KA (ევროკავშირის ერთი წევრი სახელმწიფოდან emergency relocation UK переміщення emergency response system HY Related term(s) მეორეში) განსახლება վերաբնակեցում Broader term(s) beneficiary of subsidiary protection Convention refugee resettlement EMN Asylum and Migration Classification 5. Relocation, Resettlement and Humanitarian Admission Euro Voc Classification 1011 European Union law| 2811 migration 490 EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. Relocation is an intra-EU solidarity tool enabling the transfer of persons having already international protection status and of those who are in need of international protection from one EU Member State to another EU Member State, CH and NO participate as well. 2. Directive 2001/55/EC (Temporary Protection Directive) promotes in its Art. 1 in the event of a mass influx of displaced persons from third countries a balance of effort between EU Member States in receiving and bearing the consequences of receiving such persons. 3. The EU emergency relocation programme was implemented on the basis of two Council Decisions in September 2015 and 2016 in the context of Art. 78(3) TFEU, which allows the Council to adopt provisional measures in emergency situations as part of the emergency response system meaning a temporary distribution scheme for persons in clear need of international protection to ensure a fair and balanced participation of all EU Member States to this common effort, as indicated in the European Agenda on Migration of 13 May 2015 . It was intended to alleviate the frontline EU Member States GR and IT from the disproportionate number of applicants for international protection who arrived on their territories in 2015-2016. Eligibility for the EU emergency relocation programme was limited to applicants who were in clear need of international protection and were nationals or stateless residents of those countries for which the EU-wide average recognition rate among decisions taken at first instance was 75 per cent or higher. The emergency relocation programme ended as of 26 September 2017. 4. Relocation should not be confused with resettlement which is an international solidarity and responsibility-sharing mechanism including the selection and transfer of refugees of any nationality, on a request from the United Nations High Commissioner for Refugees (UNHCR), from a State in which they have sought protection to a third state which has agreed to admit them as refugees with permanent residence status. For further information see the entry ‹resettlement› in this glossary. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 491
remain in the Member State BG оставане в държава-членка CS setrvat v členském státě DE Verbleib im EU-Mitgliedstaat EL παραμονή σε κράτος μέλος EN remain in the Member State ES permanecer en el territorio del Estado Miembro Definition(s) To remain in the territory, including at the border or in transit zones, of the EU Member State in which the application for international protection has been made or is being examined. Source(s) ET liikmesriiki jääma Art. 2(p) of Directive 2013/32/EU (Recast Asylum Procedures Directive) FI jääminen jäsenvaltioon EMN Asylum and Migration Classification FR rester dans l’État membre GA fanacht sa bhallstát 6.2 Procedure for international protection/Refugee status determination HR ostati u državi članici Euro Voc Classification HU a tagállam területén maradás 1011 European Union law| 2811 migration IT permanenza nello Stato membro LT likti valstybėje narėje LV palikt uz dzīvi dalībvalstī MT Permanenza fl-Istat Membru NL in de lidstaat blijven PL pozostawać w państwie członkowskim PT permanecer num Estado Membro RO a rămâne pe teritoriu SK zostať v členskom štáte SL ostati v državi članici SV stanna kvar i medlemsstaten NO fortsatt opphold (b); vidare opphald (n) KA ევროკავშირის წევრ სახელმწიფოში (დროებითი) დარჩენა UK залишатися в державі-члені ЄС HY 492 անդամ պետությունում մնալ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B remittance BG парични трансфери на емигранти CS remitence DE Rücküberweisung EL έμβασμα EN remittance ES remesas ET rahaülekanded FI rahalähetys FR envoi de fonds GA seoltán HR doznaka HU hazautalás IT rimessa C D Definition(s) In the migration context, personal financial, in kind or social transfers of a migrant to their families or other beneficiary(ies) in their communities of origin which may flow through a variety of formal or informal channels to support their needs. Source(s) Derived by EMN from Migration Data Portal and International Monetary Fund: Balance of Payments and International Investment Position Manual, 6th ed. (BPM6), IMF, Washington, D.C., 2009 Related term(s) J circular migration EMN Asylum and Migration Classification LV naudas pārvedumi Euro Voc Classification PL przekazy pienieżne / transfery pieniężne PT remessas RO remitenţă SK remitencie SL nakazilo SV överföring / remittering NO pengeoverføringer (b); pengeoverføringar (n) KA ფულადი გზავნილი UK грошові перекази HY դրամական փոխանցում G I MT Trasferiment ta’ flus / Rimessa NL geldovermaking / geldoverdracht / geldtransfer F H 14.2 Economic factors and impacts (such as brain drain/ gain, employment/ unemployment, labour market, economic growth, dumping) LT pinigų perlaidos E K L 2811 migration M Note(s) N 1. The International Organization of Migration (IOM) defines remittances in its Glossary on Migration 2019 as follows: Personal monetary transfers, cross border or within the same country, made by migrants to individuals or communities with whom the migrant has links, regardless of the source of the sender’s income (e.g. salary, profits from business, savings, etc.). For more information see: IOM and remittances, infosheet. 2. The International Monetary Fund (IMF) as the leading provider of statistics on international remittances defines their two main components: (1) Compensation of employees: Income earned by temporary migrant workers in the host country or the income of border, seasonal, and other short-term workers who are employed in an economy where they are not resident and of residents employed by non-resident entities. It is important to highlight that the entire income of temporary migrant workers is included in this definition, although the income may never actually be transferred (at least not entirely) to the country of origin as migrants still have to cover their own living costs. (2) Personal transfers: Transfers in cash or in kind made or received by residents (be it migrants or non-migrants). 3. Additionally, there is a distinction between formal remittances captured in the above definitions and informal remittances, which are transfers made outside the formal financial system. Statistics on inter-national remittances normally only capture formal remittance flows. 4. Increasingly, the terms ‘social remittances’ or ‘social capital transfers’ are used for non-monetary values such as ideas, knowledge, knowhow, networking and skills that migrants can transfer to communities of origin. 5. For further information see: Migration Data Portal: remittances and Joint EMN-OECD inform: Impact of COVID-19 on re-mittances in EU and OECD countries. O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 493
removal BG извеждане CS vyhoštění Definition(s) ET väljasaatmine In the global context, the act of a state in the exercise of its sovereignty in removing an alien from its territory to a certain place after refusal of admission or termination of permission to remain. In the EU context, the enforcement of the obligation to return, namely the physical transportation out of the EU Member State. FI maasta poistaminen Source(s) DE Abschiebung EL απομάκρυνση EN removal ES expulsión FR éloignement GA aistriú HR prisilno udaljenje HU kitoloncolás IT allontanamento LT išsiuntimas LV piespiedu izraidīšana MT Tneħħija NL uitzetting / verwijdering PL odesłanie (wyjazd) PT afastamento Global context: UNHCR International Thesaurus of Refugee Terminology EU-context: Art. 3(5) of Directive 2008/115/EC (Return Directive) Synonym(s) deportation Broader term(s) forced return Narrower term(s) removal order Related term(s) SK odsun expulsion return decision voluntary departure SL odstranitev Euro Voc Classification RO Îndepărtare de pe teritoriu / returnare SV avlägsnande NO uttransportering KA გაძევება UK вилучення HY 494 վտարում 2811 migration Note(s) 1. Under EU legislation, removal is a specific form of forced return. 2. While deportation and removal often are understood as synonyms, deportation is not used as a legal term in all EU Member States (only DE, FI, IE and UK define ‘deportation’ in their legislation) and is only applicable as a general concept by the public, sometimes with a negative connotation. Because of this variation, ‘removal ‘ is the preferred term to use. 3. In DE deportation and removal are defined in legislation (Sect. 57 and 58 of the Residence Act) and have different meanings. In FI deportation is synonymous with removal only in cases of a foreign citizen who: - resides in the country under a fixed term or permanent residence permit issued by Finnish authorities; - resides in the country and whose residence has been registered as provided in this Act; or - continues to reside in the country after his or her residence permit, registered residence or residence card has expired (Sect. 143 of the Finnish Aliens› Act). EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B removal order C BG заповед за извеждане D Definition(s) CS rozhodnutí o vyhoštění An administrative or judicial decision or act ordering a removal. E EL εντολή απομάκρυνσης (EL); απόφαση απομάκρυνσης (CY) Source(s) F EN removal order Synonym(s) G Broader term(s) H DE Abschiebungsanordnung ES orden de expulsión Art. 8(3) of Directive 2008/115/EC (Return Directive) deportation order ET väljasaatmisotsus FI maastapoistamismääräys FR mesure d’éloignement removal return decision GA ordú aistrithe Related term(s) HR nalog za prisilno udaljenje expulsion decision HU kitoloncolást elrendelő határozat vagy végzés Euro Voc Classification I J K 2811 migration IT provvedimento di allontanamento LT nurodymas išsiųsti L Note(s) LV lēmums par piespiedu izraidīšanu MT Ordni ta’ tneħħija NL uitzettingsbevel / verwijderingsmaatregel; bevel om het grondgebied te verlaten (BE) For some EU Member States, a return decision and removal order may occur within one administrative or judicial act as provided for in their national legislation. N PL decyzja nakazująca wyjazd O PT decisão de afastamento RO ordin de eliminare P SK príkaz na odsun / príkaz na vyhostenie SL nalog za odstranitev Q SV beslut om avlägsnande NO vedtak om uttransportering R KA ბრძანება გაძევების შესახებ UK наказ про вилучення HY M S վտարման որոշում T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 495
remunerated trainee BG платен стажант CS placený stážista DE bezahlter Auszubildender EL αμειβόμενος εκπαιδευόμενος EN remunerated trainee ES persona en prácticas remuneradas Definition(s) A third-country national who has been admitted to the territory of an EU Member State for a training period with remuneration in accordance with its national legislation. Source(s) FI palkallinen harjoittelija Derived by EMN from the definition for ‘unremunerated trainee’ in Art. 2(d) of Council Directive 2004/114/EC (Student Migration Directive) FR stagiaire rémunéré Broader term(s) ET tasustatud praktikant GA oiliúnaí a fhaigheann luach saothair trainee HR pripravnik s naknadom Related term(s) HU javadalmazásban részesülő gyakornok unremunerated trainee IT apprendista retribuito EMN Asylum and Migration Classification LT atlygintinas stažuotojas 3.3 Migration for Study and Research LV algots praktikants / stažieris Euro Voc Classification MT Persuna titħarreġ bi ħlas 2811 migration| 3206 education NL bezoldigd stagiair PL stażysta pobierający wynagrodzenie PT estagiário remunerado RO stagiar remunerat SK platený stážista SL plačani pripravnik SV avlönad praktikant NO lønnet praktikant (b); lønt praktikant (n) KA ანაზღაურებადი სტაჟიორი UK оплачуваний стажер HY 496 վճարովի փորձնակ (պրակտիկանտ) EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B repatriation C BG репатриране D Definition(s) CS repatriace The personal right of a refugee or a prisoner of war to return to their country of nationality under specific conditions laid down in various international instruments and human rights instruments as well as in customary international law. DE Repatriierung EL επαναπατρισμός EN repatriation ES repatriación Source(s) ET tagasipöördumine / repatrieerumine Derived by EMN from IOM Glossary on Migration, 2019. FI kotiuttaminen EMN Asylum and Migration Classification FR rapatriement / retour 12.1 Voluntary return GA aisdúichiú IT rimpatrio LV repatriācija MT Ripatrijazzjoni NL repatriëring / naar het land van herkomst terugkeren / terugbrengen PL repatriacja PT repatriamento RO repatriere SK repatriácia SL repatriacija SV återvandring NO repatriering KA რეპატრიაცია UK репатріація HY հայրենադարձություն G H 2811 migration J Note(s) K HU repatriálás LT repatriacija F I Euro Voc Classification HR repatrijacija E 1. This is not a synonym relating to forced return. 2. The option of repatriation is bestowed upon the individual personally and not upon the detaining power. In the law of international armed conflict, repatriation also entails the obligation of the detaining power to release eligible persons (soldiers and civilians) and the duty of the country of origin to receive its own nationals at the end of hostilities. Even if treaty law does not contain a general rule on this point, it is today readily accepted that the repatriation of prisoners of war and civil detainees has been consented to implicitly by the interested parties. Repatriation as a term also applies to diplomatic envoys and international officials in times of international crisis as well as expatriates and migrants. 3. Depending on the EU Member State, this term has different meanings / connotations: in PL, RO, NL, NO this refers specifically to repatriating their nationals back to PL, RO, NL, NO respectively. In ES, IE, IT, UK, it is often used in the context of returning third-country nationals to their country of origin. In EE, the term refers specifically to persons of Estonia or ethnic Estonians’ resettlement to Estonia. In LV, the term refers specifically to the persons of Latvian or Liiv origin to resettle with permanent residence in Latvia. In PT, the term has no legal concept, being used more as a sociological term. It is commonly used to refer to Portuguese citizens that return to Portugal, including being forced to return. 4. The term should not be confused with ‘voluntary repatriation’ which is according to the UNHCR International Thesaurus of Refugee Terminology defined as follows: ‘Return to the country of origin on the basis of the freely expressed willingness of the refugees’. The returns have to take place in conditions of safety, dignity and security. The principle of ‘voluntariness’ must be viewed in relation to both: conditions in the country of origin (calling for an informed decision) and the situation in the country of asylum (permitting a free choice). For more information, see UNHCR: Voluntary Repatriation: International Protection -handbook, 1996 . L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 497
repatriation assistance BG помощ за репатриране CS podpora osobám, které se chtějí dobrovolně vrátit do země původu DE Rückkehrhilfe für Personen, denen internationaler Schutz zuerkannt wurde; Rückkehrhilfe für Asylberechtigte (AT) EL βοήθεια για επαναπατρισμό Definition(s) Financial or in-kind assistance to beneficiaries of international protection who are in the possession of a long-term residence permit and who wish to return to their country of origin. Source(s) EN repatriation assistance Derived by EMN from Art. 35 of Directive 2011/95/EU (Recast Qualification Directive) ES asistencia al retorno Synonym(s) ET repatrieerimise abi repatriation support FI paluumuuttoavustus EMN Asylum and Migration Classification FR aide au rapatriement; aide au retour (FR) 12.1 Voluntary return GA cúnamh aisdúichithe Euro Voc Classification HR potpora u repatrijaciji HU repatriálási támogatás IT Assistenza al rimpatrio LT pagalba repatrijuoti 2811 migration Note(s) Such repatriation assistance exists in DK, FI, NO and SE. LV repatriācijas palīdzība MT Għajnuna / Assistenza għar-ripatrijazzjoni NL ondersteuning bij repatriëring / ondersteuning bij terugkeer naar het land van herkomst PL pomoc w powrocie do kraju pochodzenia PT assistência à repatriação de beneficiários de proteção internacional RO asistență pentru repatriere SK pomoc pri repatriácii SL pomoč pri repatriaciji SV återvandringsbidrag NO returhjelp til opprinnelsesland (b); returhjelp til opphavsland (n) KA რეპატრიაციის ხელშეწყობა UK допомога в репатріації HY 498 հայրենադարձության աջակցություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B representative BG представител CS zástupce C D Definition(s) E ES representante legal In the migration context, a person or an organisation appointed by the competent bodies in order to assist and represent a child in different procedures (such as in procedures for international protection) with a view to ensuring the best interests of the child (BIC) and exercising legal capacity for the minor where necessary. ET esindaja Source(s) H DE Vertreter (EU acquis); Stellvertreter (DE, LU); gesetzlicher Vertreter (AT, LU) EL εκπρόσωπος EN representative FI edustaja FR représentant (EU acquis, LU); représentant légal; administrateur ad hoc (FR, LU) GA ionadaí HR posebni skrbnik HU képviselő IT rappresentante LT atstovas LV pārstāvis MT Rappreżentant(a) / Prokuratur(-triċi) NL vertegenwoordiger PL przedstawiciel PT representante legal RO reprezentant SK opatrovník SL zakoniti zastopnik SV företrädare NO representant KA წარმომადგენელი UK представник HY ներկայացուցիչ Derived by EMN from Art. 2(n) of Directive 2013/32/EU (Recast Asylum Procedures Directive) and Fundamental Rights Agency (FRA): Guardianship for children deprived of parental care, 2015, Synonym(s) legal representative F G I J K Broader term(s) L guardian Related term(s) M separated child unaccompanied minor EMN Asylum and Migration Classification N Euro Voc Classification O 7.2 Minors and unaccompanied minors 2806 family| 2811 migration P Note(s) 1. Neither in the international context nor at EU or national level is there a uniform definition and use of the terms guardian and (legal) representative. Sometimes both terms are understood as synonyms. An overview of different terms used in international and EU context can be found in: Fundamental Rights Agency (FRA): Guardianship for children deprived of parental care, 2015. 2. The EMN Glossary puts the emphasis on the functions of the appointed person, rather than on the terminology. The term ‘representative’ reflects the narrower concept and encompasses only the legal representation of the child within particular legal or administrative proceedings as one of the three key functions of guardianship, and thus is not responsible for the full range of tasks normally assigned to a guardian. A representative can be a person or an organisation, in the latter case the organisation shall designate a person responsible for carrying out the duties of a representative. A guardian and a representative can be the same person, but do not necessarily have to be. 3. The representative differs also from a qualified lawyer or other legal professional who provide legal assistance, speak on behalf of the child and legally represent them in written statements and in person before administrative and judicial authorities in criminal, asylum or other legal proceedings as provided in national law. For more information see Fundamental Rights Agency (FRA): Guardianship systems for children deprived of parental care in the European Union, Summary, 2018. 4. The inconsistent use of both terms in EU legislation can be seen e.g. in Art. 4(2f) of Amended Proposal for a Regulation establishing a common procedure for international protection in the Union and repealing Directive 2013/32/EU COM/2020/611 final as it uses the term ‹guardian› with the previous definition of ‹representative› in Art. 2(n) of Directive 2013/32/EU (Recast Asylum Procedures Directive). EMN ASYLUM AND MIGRATION GLOSSARY 10.0 499 Q R S T U V W X Y Z
researcher BG научен работник CS výzkumný pracovník DE Forscher EL ερευνητής EN researcher ES investigador ET teadlane FI tutkija FR chercheur Definition(s) In the EU migration context, a third-country national holding a doctoral degree or an appropriate higher education qualification, which gives that thirdcountry national access to doctoral programmes and who is selected by a research organisation and admitted to the territory of an EU Member State for carrying out a research activity for which such qualification is normally required. Source(s) GA taighdeoir Art. 3(2) of Directive (EU)2016/801 (Recast Researchers and Students Directive) HR istraživač Related term(s) HU kutató LT tyrėjas school pupil student unremunerated trainee LV pētnieks EMN Asylum and Migration Classification IT ricercatore MT Riċerkatur (-triċi) 3.3 Migration for Study and Research NL onderzoeker Euro Voc Classification PL naukowiec 2811 migration| 3206 education PT investigador RO cercetător SK výskumník / výskumný pracovník SL raziskovalec SV forskare NO forsker (b); forskar (n) KA მკვლევარი UK дослідник HY 500 հետազոտող EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B resettled refugee BG презаселен бежанец C D Definition(s) CS přesídlený uprchlík DE neuangesiedelter Flüchtling EL πρόσφυγας που επανεγκαθίσταται EN resettled refugee ES refugiado reasentado ET ümberasustatud pagulane FI uudelleensijoitettu pakolainen FR réfugié réinstallé GA dídeanaí athlonnaithe HR preseljena izbjeglica HU áttelepített menekült IT rifugiato reinsediato LT perkeltas pabėgėlis LV pārmitināts bēglis MT Rifuġjat(a) risistemat(a) NL uitgenodigde vluchteling (NL); hervestigde vluchteling (BE) In the global context, a refugee who is identified by the United Nations High Commissioner for Refugees (UNHCR) and who is transferred from the country in which they have sought protection to a third state which has agreed to admit them as refugees with permanent residence status. In the EU context, a third-country national or stateless person who, on a resettlement request from UNHCR based on their need for international protection, are transferred from a third country to a Member State where they are permitted to reside with one of the following statuses: (i) refugee status within the meaning of Art. 2(d) of Directive 2011/95/EU (Recast Qualification Directive); or (ii) a status which offers the same rights and benefits under national and European Union law as refugee status. E Source(s) M PT refugiado reinstalado Global context: Derived by EMN from the Glossary of the UNHCR Resettlement Handbook EU context: Derived by EMN from Art. 2(a) of Regulation (EU) No 516/2014 (AMIF-Regulation) RO refugiat relocat Synonym(s) PL przesiedlony uchodźca SK presídlená osoba / presídlený utečenec / presídlenec SV kvotflykting Programme refugee quota refugee resettled person NO overføringsflyktning Broader term(s) SL preseljeni begunec KA (ევროკავშირიდან მესამე ქვეყანაში / მესამე ქვეყნიდან ევროკავშირში) განსახლებული ლტოლვილი F G H I J K L N O P Q refugee R Related term(s) UK переселений біженець refugee in transit resettlement S HY EMN Asylum and Migration Classification T Euro Voc Classification U վերաբնակեցված փախստական 5. Relocation, Resettlement and Humanitarian Admission 2811 migration V Note(s) 1. It is the United Nations High Commissioner for Refugees (UNHCR) that, together with the relevant authorities in the State concerned, decides which refugees should be accepted; their refugee status is established by the UNHCR and accepted by the State in advance of entering the State. 2. In some cases, national authorities assess in addition as to whether the person concerned is a refugee. 3. There are different terms used in EU Member States depending on different legal concepts. In some Member States such refugees are accepted as part of a yearly resettlement programme. 4. IE uses the term ‘programme refugee’ in a wider context than ‘resettlement’ and defines in Section 24 of the Irish Refugee Act, 1996 as follows: ‘a person to whom leave to enter and remain in the State for temporary protection or resettlement as part of a group of persons has been given by the Government’. EMN ASYLUM AND MIGRATION GLOSSARY 10.0 501 W X Y Z
resettlement BG презаселване CS přesídlení DE Neuansiedlung EL επανεγκατάσταση EN resettlement ES reasentamiento ET ümberasustamine FI uudelleensijoittaminen FR réinstallation GA athlonnú HR preseljenje HU áttelepítés IT reinsediamento LT perkėlimas LV pārmitināšana MT Issetilljar mill-ġdid NL hervestiging PL przesiedlenie PT reinstalação RO relocare SK presídlenie / presídľovanie SL preselitev SV vidarebosättning NO gjenbosetting (b); gjenbusetjing (n) KA (ევროკავშირიდან მესამე ქვეყანაში / მესამე ქვეყნიდან ევროკავშირში) განსახლება UK переселення HY վերաբնակեցում Definition(s) In the global context, the selection and transfer of refugees from a State in which they have sought protection to a third state which has agreed to admit them as refugees with permanent residence status. In the EU context, admission following a referral from the United Nations High Commissioner for Refugees (UNHCR) of third-country nationals or stateless persons from a third country to which they have been displaced, to the territory of the EU Member States, and who are granted international protection and have access to durable solutions in accordance with Union and national law. Source(s) Global context: Glossary of the UNHCR Resettlement Handbook EU context: Derived by EMN from Art. 2(8) of Regulation (EU) 2021/1147 (AMIF-Regulation) Broader term(s) legal pathway Narrower term(s) resettlement programme Related term(s) durable solutions humanitarian admission humanitarian visa relocation EMN Asylum and Migration Classification 5. Relocation, Resettlement and Humanitarian Admission Euro Voc Classification 2811 migration Note(s) 1. The status provided following resettlement ensures protection against refoulementand provides resettled refugees and their family or dependants with access to rights similar to those enjoyed by nationals. Resettlement also carries with it the opportunity to eventually become a naturalised citizen of the resettlement country. For this reason, resettlement is a durable solution as well as a tool for the protection of refugees. 2. This term should not be confused with ‘relocation’. 3. EU legislation distinguishes between humanitarian admission and resettlement, with resettlement specifically designed for formally recognised refugees, while humanitarian admission may imply the grant-ing of international protection or humanitarian protection under national laws. 502 EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B resettlement programme BG програма за презаселване C D Definition(s) CS přesídlovací program In the global context, a coordinated activity undertaken in partnership with United Nations High Commissioner for Refugees (UNHCR) and other non-governmtanl organisations (NGOs) that includes specific processes like the identification in the field of refugees in need of resettlement, to screening, processing, reception and integration. In the EU context, voluntary programmes by which EU Member States aim to provide international protection and durable solutions in their territories to refugees and displaced persons identified as eligible for resettlement by UNHCR, and which include actions that the Member States implement to assess the resettlement needs and transfer the persons concerned to their territories, with a view to granting them a secure legal status and to promoting their effective integration. acti DE Neuansiedlungsprogramm EL πρόγραμμα επανεγκατάστασης EN resettlement programme ES programa de reasentamiento ET ümberasustamisprogramm FI uudelleensijoittamisohjelma FR programme de réinstallation GA clár athlonnaithe HR program preseljenja HU áttelepítési program IT programma di reinsediamento LT perkėlimo programa LV pārmitināšanas programma Source(s) MT Programm ta’ risistemazzjoni PL Program Przesiedleń Global context: Developed by EMN EU context: Derived by EMN from Recital 18 of Decision 573/2007/EC establishing the European Refugee Fund PT programa de reinstalação Broader term(s) NL hervestigingsprogramma resettlement RO program de relocare SK presídľovací program / program presídľovania durable solutions SV program för vidarebosättning EMN Asylum and Migration Classification 5. Relocation, Resettlement and Humanitarian Admission KA (მესამე ქვეყნიდან ევროკავშირში) Euro Voc Classification 2811 migration H I J K L M N Q R UK програма переселення HY G P NO gjenbosettingsprogram (b); gjenbusetjingsprogram (n) განსახლების პროგრამა F O Related term(s) SL program trajne preselitve E S վերաբնակեցման ծրագիր T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 503
residence document BG документ за пребиваване CS doklad o pobytu DE Aufenthaltsdokument; Aufenthaltstitel (EU acquis) EL έγγραφο διαμονής EN residence document ES documento de residencia ET elamisluba (dokument) FI oleskeluun oikeuttava asiakirja FR titre de séjour (EU acquis) / document de séjour GA doiciméad cónaithe HR dokument o boravku HU tartózkodásra jogosító okmány IT titolo di soggiorno Definition(s) A document issued by the authorities of an EU Member State authorising a third-country national to stay in its territory, including the documents substantiating the authorisation to remain in the territory under temporary protection arrangements or until the circumstances preventing a removal order from being carried out no longer apply, with the exception of visas and residence authorisations issued during the period required to determine the responsible EU Member State as established in Regulation (EU) No 604/2013 (Dublin III Regulation) or during examination of an application for international protection or an application for a residence permit. Source(s) LT teisę gyventi šalyje patvirtinantis dokumentas Derived by EMN from Art. 2(l) of Regulation (EU) No 604/2013 (Dublin III Regulation) LV uzturēšanās dokuments Broader term(s) MT Dokument ta’ residenza right of residence NL verblijfsdocument Narrower term(s) PL dokument pobytowy residence permit PT título de residência Related term(s) RO document de şedere SK doklad o pobyte SL dokument za prebivanje SV uppehållstillstånd NO oppholdsdokument (b); opphaldsdokument (n) KA ბინადრობის დოკუმენტი UK документ, що підтверджує проживання HY 504 residence permit travel document EMN Asylum and Migration Classification 8.1 Right of residence, authorisation of stay/long-term visa, / residence permits Euro Voc Classification 2811 migration բնակության փաստաթուղթ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B residence permit C BG разрешение за пребиваване D Definition(s) CS povolení k pobytu DE Aufenthaltstitel (EU acquis); Aufenthaltserlaubnis / Niederlassungserlaubnis (DE) Any authorisation issued by the authorities of an EU Member State allowing a third-country national to stay legally on its territory. EL άδεια διαμονής (EL); άδεια παραμονής (CY) Source(s) E F Derived by EMN from Regulation (EU) No 265/2010 (Long Stay Visa Regulation) G Broader term(s) H FR permis de séjour (EU acquis) / autorisation de séjour / titre de séjour Narrower term(s) I GA cead cónaithe Related term(s) J EN residence permit ES permiso de residencia ET elamisluba residence document FI oleskelulupa HR dozvola boravka HU tartózkodási engedély IT permesso di soggiorno LT leidimas gyventi LV uzturēšanās atļauja MT Permess ta’ residenza NL verblijfsvergunning PL zezwolenie na pobyt PT autorização de residência RO permis de şedere SK povolenie na pobyt SL dovoljenje za prebivanje SV uppehållstillstånd NO oppholdstillatelse (b); opphaldsløyve (n) KA ბინადრობის ნებართვა single permit EU Blue Card work permit K EMN Asylum and Migration Classification 8.1 Right of residence, authorisation of stay/long-term visa, / residence permits L Euro Voc Classification M 2811 migration N Note(s) Residence permits include all ƒ residence permits issued by EU Member States in accordance with the uniform format of Council Regulation (EC) No 1030/2002 and ƒ residence cards issued in accordance with Directive 2004/38/EC, as well as ƒ other documents issued by an EU Member State to third-country nationals which entitle them to reside in its territory and which have been the subject of a notification and subsequent publication pursuant to Art. 39 of Regulation (EU) 2016/399 with the exception of: (i) temporary permits; and (ii) visas issued by EU Member States. UK посвідка на проживання HY O P Q R S կացության թույլտվություն T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 505
return BG връщане CS návrat DE Rückkehr EL επιστροφή EN return ES retorno ET tagasipöördumine/tagasisaatmine FI paluu/palauttaminen FR retour GA filleadh HR povratak Definition(s) The movement of a person going from a host country back to a country of origin, country of nationality or usual residence usually after spending a significant period of time in the host country whether voluntary or forced, assisted or spontaneous. Source(s) Developed by EMN Synonym(s) return migration Narrower term(s) IT ritorno / rimpatrio forced return voluntary departure voluntary return LT grąžinimas Related term(s) HU visszatérés LV atgriešana (EU acquis); izraidīšana MT Ritorn / Tluq lura NL terugkeer PL powrót PT retorno RO returnare SK návrat SL vrnitev / vračanje SV återvändande NO retur KA დაბრუნება UK повернення HY 506 վերադարձ readmission reintegration returnee Euro Voc Classification 2811 migration Note(s) 1. The International Organization for Migration (IOM) definition covers all categories of return of migrants: return within the territorial boundaries of a country, as in the case of returning IDPs and demobilised combatants; or from a host country (either transit or destination) to the country of origin, as in the case of persons who have resided legally in a country, migrant workers, refugees, asylum seekers and qualified nationals; or the way the return is implemented, e.g. voluntary, forced, assisted and spontaneous return. It does not cover stays shorter than three months (such as holiday visits or business meetings and other visits typically considered to be for a period of time of less than three months). 2. In the context of Council Directive 2008/115/EC (Return Directive) , ‘return’ as defined in Art. 3(3), is understood as return which occurs once a return decision has been issued. This glossary uses the term ‹forced return› to describe ‹return› as defined in the Return Directive. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B Return Coordinator BG координатор по въпросите на връщането CS návratový koordinátor DE Rückkehrkoordinator / Rückführungskoordinator EL Συντονιστής Επιστροφών EN Return Coordinator ES coordinador de retorno ET tagasisaatmise koordinaator FI palauttamisasioiden koordinaattori FR coordinateur chargé des retours GA comhordaitheoir um fhilleadh HR koordinator za povratak HU visszatérési koordinátor IT coordinatore per i rimpatri LT grąžinimo koordinatorius LV atgriešanas koordinators MT Koordinatur għar-Ritorn NL terugkeercoördinator PL Koordynator ds. Powrotów C D Definition(s) Person appointed by the European Commission to bring together different strands of return policy and to support the consistent and coherent implementation of return policy as well as the establishment of a common EU return system. Source(s) Derived by EMN from European Commission: Communication on a New Pact on Migration and Asylum, COM(2020) 609 final and IATE Synonym(s) J EU Return Coordinator Broader term(s) K return Related term(s) L European Border and Coast Guard Agency (Frontex) High-Level Network for Return M EMN Asylum and Migration Classification SK koordinátor pre návraty Euro Voc Classification SV återvändandesamordnare NO returkoordinator KA კოორდინატორი დაბრუნების საკითხებში UK координатор з питань повернення HY վերադարձի գործընթացը համակարգող G I RO Coordonator pentru returnare SL koordinator za vračanje F H 2.2 EU (e.g. Common European Asylum System, Qualification Directive, European Agenda for Migration)| 12. Return and Readmission PT Coordenador para Retorno E 1011 European Union law| 2811 migration N O P Note(s) 1. The function of a return coordinator was created under the New Pact on Migration and Asylum. 2. The first EU Return Coordinator was appointed on 2 March 2022 to establish an effective and common European return system by coordinating actions between the EU and EU Member States. The return coordinator is supported by EU Member States’ representatives of the High-Level Network for Return and the European Border and Coast Guard Agency (Frontex). 3. The work of both the EU Return Coordinator and the High-Level Network will be strategically aligned through an operational return strategy. For more information see EuropeanCommission: Policy Document: Towards an operational strategy for more effective returns, COM(2023) 45 final. Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 507
return counselling BG консултиране относно връщането CS návratové poradenství DE Rückkehrberatung EL συμβουλευτική επιστροφών EN return counselling ES Retorno asistido ET tagasisaatmise nõustamine FI paluuneuvonta FR conseil en matière de retour GA comhairleoireacht fillte HR savjetovanje o povratku Definition(s) Individual return advice to potential returnees, including – depending on the circumstances of the case - information on the obligation to leave the country and the consequences if not leaving, different return support schemes, information on the situation in the country of return and the potential prospects for the returnees for a new start in their country of return with the aim to encourage (assisted) voluntary return. Source(s) Developed by EMN Related term(s) IT counselling sul rimpatrio assisted voluntary return and reintegration programme (AVRR) pre-departure counselling LT konsultavimas grąžinimo klausimais EMN Asylum and Migration Classification HU visszatérési tanácsadás LV konsultēšana par atgriešanu / piespiedu izraidīšanu MT Servizz ta’ pariri għar-ritorn NL Terugkeerbegeleiding PL doradztwo w zakresie powrotu PT aconselhamento na área do retorno RO consiliere pentru returnare / consiliere în materie de returnare SK návratové poradenstvo SL svetovanje pri vračanju 12. Return and Readmission Euro Voc Classification 2811 migration Note(s) 1. Potential returnees encompass rejected applicants for international protection, applicants while their application is still pending, irregular migrants and other persons who are obliged to return to the their country of origin or another third country. 2. The term pre-departure counselling is sometimes used as a synonym, but also in a broader context not related to return. SV återvändanderådgivning NO returrådgivning KA კონსულტაცია დაბრუნებასთან დაკავშირებით UK консультації з повернення HY 508 վերադարձի խորհրդատվություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B return decision C BG решение за връщане CS rozhodnutí o návratu DE Rückkehrentscheidung (EU acquis); Rückführungsentscheidung (DE) An administrative or judicial decision or act, stating or declaring the stay of a third-country national to be illegal and imposing or stating an obligation to return. EL απόφαση επιστροφής Source(s) EN return decision ES resolución de expulsión ET lahkumisettekirjutus FR décision de retour F Art. 3(4) of Council Directive 2008/115/EC (Return Directive) G Synonym(s) H I Broader term(s) GA cinneadh fillte removal HR odluka o povratku J Narrower term(s) HU kiutasítást elrendelő határozat K removal order IT decisione di ritorno / rimpatrio Related term(s) LT sprendimas grąžinti / sprendimas dėl grąžinimo L expulsion decision enforcement measure voluntary departure LV atgriešanas lēmums (EU acquis); izbraukšanas rīkojums / lēmums par piespiedu izraidīšanu MT Deċiżjoni ta’ ritorn M Euro Voc Classification NL terugkeerbesluit PL decyzja o powrocie PT decisão de afastamento / notificação para abandono SK rozhodnutie o návrate E obligation to leave obligation to return FI palauttamispäätös RO decizie de returnare D Definition(s) 2811 migration N Note(s) O For some EU Member States, a return decision and removal order may occur within one administrative or judicial act as provided for in their national legislation. SL odločba o vrnitvi Q SV beslut om återvändande NO returvedtak R KA გადაწყვეტილება დაბრუნების შესახებ UK рішення про повернення HY P S վերադարձի որոշում T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 509
return intervention BG намеса във връщането CS návratová intervence Definition(s) ES Intervención de retorno An activity of the European Border and Coast Guard Agency (Frontex) providing EU Member States with enhanced technical and operational assistance consisting of the deployment of European return intervention teams to EU Member States and the organisation of return operations. ET tagasisaatmisega seotud sekkumine Source(s) DE Rückführungseinsatz / Rückkehreinsatz EL επέμβαση επιστροφής EN return intervention FI palauttamisinterventio FR intervention en matière de retour GA Idirghabháil um fhilleadh HR intervencija vraćanja HU visszaküldési intervenció IT intervento di rimpatrio LT grąžinimo pagalba LV atgriešanas nodrošināšanas operācija MT Intervent għal operazzjoni ta’ ritorn NL terugkeerinterventie PL interwencja powrotowa PT intervenção de regresso RO intervenție pentru returnare SK návratová intervencia SL posredovanje na področju vračanja SV återvändandeintervention NO Støtte til gjennomføring av retur (b); Stønad til å gjennomføre retur (n) Art. 2(28) of Regulation (EU) 2019/1896 (European Border and Coast Guard Regulation) Broader term(s) removal Narrower term(s) Rapid Border Intervention Team (RABIT) Related term(s) return operation Euro Voc Classification 2811 migration Note(s) In contrast to return operations, (rapid) return interventions may be provided by Frontex in circumstances where an EU Member State is facing a burden or specific and disproportionate challenges when implementing the obligation to return third-country nationals upon request of that EU Member State. Such return interventions shall be based on an operational plan drawn up by the executive director of Frontex in agreement with the host EU Member State and the participating EU Member States. They shall be financed or co-financed by Frontex. (see Art. 33 of the Regulation (EU) 2016/1624 (European Border and Coast Guard Regulation) KA დაბრუნების პროცესში ოპერაციული ჩარევა UK втручання в повернення HY 510 վերադարձի միջամտություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B return operation BG операция по връщане CS návratová operace C D Definition(s) ES Operación de retorno An operation that is coordinated by the European Border and Coast Guard Agency (Frontex) and involves technical and operational reinforcement being provided by one or more EU Member States under which returnees from one or more EU Member States are returned either on a forced or voluntary basis. ET tagasisaatmisoperatsioon Source(s) DE Rückführungsaktion / Rückkehraktion EL επιχείρηση επαναπατρισμού EN return operation FI palauttamisoperaatio FR opération de retour GA Oibríocht um fhilleadh HR operacija vraćanja HU visszaküldési művelet IT operazione di rimpatrio LT grąžinimo operacija LV atgriešanas operācija (EU acquis) / izraidīšanas operācija MT Operazzjoni ta’ ritorn NL terugkeeroperatie PL operacja powrotowa PT Operação de regresso RO operațiune de returnare SK návratová operácia SL operacija vračanja SV återvändandeinsats Art. 2(27) of of Regulation (EU) 2019/1896 (European Border and Coast Guard Regulation) Synonym(s) joint return operation JRO F G H I J Related term(s) K forced return voluntary return L Euro Voc Classification 2811 migration M Note(s) 1. Most EU Member States, CH and NO organise return operations individually at the national level. There is, however, a possibility for two or more countries to organise a joint return operation. 2. According to Art. 28 of the Regulation (EU) 2016/1624 (European Border and Coast Guard Regulation) Frontex shall provide the necessary assistance and either at the request of one or several participating EU Member States or on its own initiative, ensure the coordination or the organisation of joint return operations, including through the chartering of aircraft. NO Returoperasjon KA დაბრუნების ოპერაცია N O P Q R UK операція з повернення HY E S վերադարձի գործողություն T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 511
returnee BG върнат CS navracený cizinec DE Rückkehrer EL επαναπατριζόμενος EN returnee ES extranjero retornado ET tagasipöörduja FI palaaja/palautettava FR personne éloignée (retour forcé) / personne retournée (retour volontaire ou spontané) Definition(s) A person going from a host country back to a country of origin, country of nationality or habitual residence usually after spending a significant period of time in the host country whether voluntary or forced, assisted or spontaneous. Source(s) EMN: Programmes and Strategies in the EU Member States fostering Assisted Return to and Reintegration in Third Countries, 2011 Related term(s) GA imirceach fillteach return HR povratnik Euro Voc Classification HU visszatérő IT persona che compie ritorno LT grįžtantysis / grąžinamasis LV izraidāmais MT Migrant(a) ritornat(a) NL terugkeerder PL osoba powracająca 2811 migration Note(s) The definition covers all categories of migrants (persons who have resided legally in a country as well as failed asylum seekers) and different ways the return is implemented (e.g. voluntary, forced, assisted and spontaneous). It does not cover stays shorter than three months (such as holiday visits or business meetings and other visits typically considered to be for a period of time of less than three months). PT retornado RO persoană returnată SK navrátilec SL oseba v postopku vračanja SV återvändare NO den personen som vender hjem (b); den personen som vender heim (n) KA დასაბრუნებელი პირი UK репатріант HY 512 վերադարձող EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B right of asylum C BG право на убежище (от гледна точка на държавата, предоставяща закрила) CS právo azylu DE Recht, Asyl zu gewähren; Asylrecht (DE) EL δικαίωμα ασύλου EN right of asylum ES derecho de asilo ET õigus varjupaigale FI turvapaikkaoikeus FR droit d’accorder d’asile / droit d’asile GA ceart tearmainn HR pravo države da pruži utočište/odobri azil HU menedékjog IT diritto di asilo LT prieglobsčio suteikimo teisė LV patvēruma tiesības MT Dritt mogħti għall-ażil D Definition(s) The right of the State, in virtue of its territorial sovereignty and in the exercise of its discretion, to allow a non-national to enter and reside, and to resist the exercise of jurisdiction by any State over that individual. E Source(s) G Synonym(s) H Broader term(s) I Related term(s) J EMN Asylum and Migration Classification K UNHCR International Thesaurus of Refugee Terminology right to grant asylum asylum right to asylum 4. International Protection and other Types of Protection| 4.2.1 Constitutional Asylum Euro Voc Classification PT direito de asilo RO dreptul la azil SK právo udeliť azyl SL pravica do azila SV asylrätt M Note(s) N 1. In some States there are narrower or broader criteria than that laid down in the Geneva Refugee Convention and Protocol. 2. The International Organization for Migration (IOM) uses a generic term, in two senses: ƒ the right to grant asylum (a State may grant asylum in its territory to any person at its own discretion) and ƒ the right to be granted asylum either vis-à-vis the State in whose territory asylum is requested, or visà-vis the pursuing State. NO rett til å gi beskyttelse / asyl (b); rett til å gje vern / asyl (n) O P Q R KA თავშესაფრით უზრუნველყოფის უფლება UK право притулку HY L 1231 international law| 2811 migration NL asielrecht / recht van asiel PL prawo do udzielenia azylu F S ապաստանի իրավունք T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 513
right of residence BG право на пребиваване CS právo na pobyt Definition(s) DE Aufenthaltsrecht The right to regularly reside in a given country, according to the migration law of that country. EL δικαίωμα διαμονής Source(s) EN right of residence Developed by EMN ES derecho de residencia Synonym(s) ET elamisõigus right to reside FI oleskeluoikeus Narrower term(s) FR droit de séjour GA ceart cónaithe HR pravo na boravak HU tartózkodási jog IT diritto di soggiorno LT teisė gyventi šalyje LV uzturēšanās tiesības MT Dritt għar-residenza NL verblijfsrecht PL prawo pobytu PT direito de residência RO drept de şedere / dreptul de rezidență SK právo zdržiavať sa v krajine / právo na pobyt v krajine SL pravica do prebivanja residence document residence permit Related term(s) host country EMN Asylum and Migration Classification 8.1 Right of residence, authorisation of stay/long-term visa, / residence permits Euro Voc Classification 2811 migration Note(s) In the EU context, the right of residence for EU citizens is covered by Council Directive 2004/38/EC (Free Movement Directive) which differentiates between the right of residence for up to three months (Art. 6) and the right of residence for more than three months (Art. 7). EEA and Swiss citizens enjoy the same rights as Union citizens within the European area of free movement. SV uppehållsrätt NO rett til opphold (b); rett til opphald (n) KA ბინადრობის უფლება UK право на проживання HY 514 կացության իրավունք EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B right to an effective remedy BG право на ефективни правни средства за защита C D Definition(s) CS právo na účinný opravný prostředek E ES Derecho a recurrir A general principle of European Union law set out in Art. 47 of the Charter of Fundamental Rights of the European Union which gives everyone whose rights and freedoms guaranteed by EU law are violated the right to a legal remedy before a national authority or tribunal notwithstanding that the violation has been committed by persons acting in an official capacity. ET õigus tõhusale õiguskaitsevahendile Source(s) H DE Recht auf einen wirksamen Rechtsbehelf / Recht auf Rechtsbehelf; Recht auf Berufung (DE, LU) EL δικαίωμα πραγματικής προσφυγής EN right to an effective remedy Derived by EMN from Art. 47 of the Charter of Fundamental Rights of the European Union FI oikeus tehokkaisiin oikeussuojakeinoihin FR droit à un recours effectif GA an ceart chun leighis éifeachtaigh agus chun trialach córa / an ceart chun leighis éifeachtaigh agus chun trialach cothroime HR pravo na djelotovran pravni lijek HU hatékony jogorvoslathoz való jog Charter of Fundamental Rights of the European Union fundamental rights IT diritto a un ricorso effettivo Euro Voc Classification J right to appeal Broader term(s) 1236 rights and freedoms Note(s) L N The right to an effective remedy is based on Art. 13 of the European Convention on Human Rights. NL Recht op een doeltreffende voorziening in rechte K M LV tiesības uz efektīvu tiesību aizsardzību MT Dritt għal rimedju effettiv G I Synonym(s) LT teisė į veiksmingą teisinę gynybą F PL prawo do skutecznego środka prawnego O PT direito de recurso RO drept la o cale de atac eficientă / dreptul la o cale de atac eficientă P SK právo na účinný opravný prostriedok Q SL pravica do učinkovitega pravnega sredstva R SV rätt till ett effektivt rättsmedel NO rett til et effektivt rettsmiddel KA სამართლებრივი დაცვის ქმედითი საშუალების S UK право на ефективний засіб правового захисту T უფლება HY իրավական պաշտպանության արդյունավետ միջոցի իրավունք U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 515
right to asylum BG право на убежище (от гледна точка на търсещия закрила) CS právo na azyl DE Recht auf Asyl EL δικαίωμα στο άσυλο EN right to asylum ES derecho de asilo ET õigus varjupaika taotleda FI oikeus turvapaikkaan FR droit d’asile / droit à l’asile / droit de demander l’asile GA ceart ar thearmann HR pravo na azil HU menedékhez való jog IT diritto all’asilo LT teisė į prieglobstį LV tiesības uz patvērumu Definition(s) The right of a person to seek asylum, guaranteed with due respect by the rules of the Geneva Refugee Convention and Protocol and in accordance with the Treaty on the Functioning of the European Union (TFEU). Source(s) Art. 18 of the European Charter of Fundamental Rights and Art. 14 of the Universal Declaration of Human Rights Synonym(s) right to seek asylum Related term(s) right to asylum EMN Asylum and Migration Classification 4.2.1 Constitutional Asylum Euro Voc Classification 1231 international law| 2811 migration MT Dritt għall-ażil NL recht op asiel PL prawo do ochrony międzynarodowej PT direito ao asilo RO dreptul la azil Note(s) 1. In the European Union, the right to asylum is enshrined in Art. 18 of the Charter of Fundamental Rights of the European Union. 2. Refugees have no enforceable right in conventional international law to be granted asylum by a State. It is contested whether customary international law has embraced the individual right to asylum. SK právo na azyl SL pravica do azila SV rätt till asyl NO rett til beskyttelse (b); rett til vern (n) KA თავშესაფრის უფლება UK право на притулок HY 516 ապաստանի իրավունք EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B right to family life BG право на семеен живот CS právo na rodinný život DE Recht auf Familienleben EL δικαίωμα στην οικογενειακή ζωή EN right to family life ES derecho a la vida en familia ET õigus pere(konna)elule FI oikeus perhe-elämään FR droit à la vie familiale GA ceart chun saol teaghlaigh C A right enshrined in Arts. 7, 9 and 33 of the Charter of Fundamental Rights of the European Union and Art. 8 of the European Convention on Human Rights (ECHR). E Source(s) G Narrower term(s) H Related term(s) I European Charter of Fundamental Rights right to family unity IT diritto alla vita familiare chain migration family formation family reunification family migration LT teisė į šeimos gyvenimą Euro Voc Classification HR pravo na obiteljski život HU családi élethez való jog LV tiesības uz ģimenes dzīvi D Definition(s) J K MT Dritt għal ħajja f’familja / familjari 1011 European Union law| 1236 rights and freedoms| 2806 family NL recht op eerbiediging van familie- en gezinsleven / recht op familie- en gezinsleven Note(s) PL prawo do życia rodzinnego PT direito à vida familiar RO dreptul la viaţă de familie L M There is a distinction between the right to family life and the right to family unity. The right to family life is a fundamental right enshrined in the Charter of Fundamental Rights of the European Union. The right to family unity relates more to the purpose and procedural aspects of entry and stay for the purpose of reuniting a family. SK právo na rodinný život N O P SL pravica do družinskega življenja SV rätt till familjeliv Q NO rett til familieliv KA ოჯახური ცხოვრების უფლება R UK право на сімейне життя HY F S ընտանեկան կյանքի իրավունք T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 517
right to family unity BG право на запазването на целостта на семейството CS právo na zachování jednoty rodiny DE Recht auf Familieneinheit / Recht auf Wahrung des Familienverbandes EL δικαίωμα στην οικογενειακή ενότητα EN right to family unity ES derecho a la unidad de la familia Definition(s) In the context of a refugee, a right provisioned in Art. 23 of Directive 2011/95/EU (Recast Qualification Directive) and in Art. 12 of Directive 2013/33/EU (Recast Reception Conditions Directive) obliging EU Member States to ensure that family unity can be maintained. Source(s) FR droit à l’unité familiale Derived by EMN from Art. 23 of Directive 2011/95/EU (Recast Qualification Directive) and Art. 12 of Directive 2013/33/EU (Recast Reception Conditions Directive) GA ceart chun aontacht teaghlaigh Synonym(s) ET õigus perekonna ühtsusele FI oikeus perheen yhtenäisyyteen HR pravo na cjelovitost obitelji HU a család egységéhez való jog IT diritto all’unità familiare LT teisė į šeimos vientisumą LV tiesības uz ģimenes vienotību MT Dritt għall-għaqda / għall-unità tal-familja NL recht op instandhouding van het (kern-)gezin / recht op eenheid van het gezin PL prawo do jedności rodziny PT direito à unidade familiar RO dreptul la unitatea familiei SK právo na jednotu rodiny SL pravica do enotnosti družine / pravica do združitve družine SV rätt till familjesammanhållning NO rett til familiens enhet (b); rett til familieeining (n) KA ოჯახის ერთიანობის უფლება UK право на єдність сім’ї HY 518 ընտանիքի միասնության իրավունք family unity principle of family unity Broader term(s) right to family life Narrower term(s) family reunification Related term(s) chain migration family formation family migration EMN Asylum and Migration Classification 3.2 Migration for Family Reasons| 7.3 Families Euro Voc Classification 1231 international law| 2806 family Note(s) There is a distinction between the right to family unity and the right to family life. The right to family unity relates more to the purpose and procedural aspects of entry and stay for the purpose of reuniting a family, in order to meet the fundamental rights enshrined in the Charter of Fundamental Rights of the European Union. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B right to free movement BG право на свободно движение C D Definition(s) CS právo volného pohybu E The right of EU citizens and legally resident thirdcountry nationals (in accordance with the Treaty establishing the European Community) to move and reside freely within the territory of the EU Member States. DE Recht auf Freizügigkeit EL δικαίωμα ελεύθερης κυκλοφορίας (EL); δικαίωμα ελεύθερης διακίνησης (CY) EN right to free movement F G Source(s) ES derecho a la libre circulación ET vaba liikumise õigus Derived by EMN from Art. 45 of the European Charter of Fundamental Rights FI oikeus liikkua vapaasti Synonym(s) FR droit à la libre circulation I freedom of movement GA ceart saorghluaiseachta HR pravo slobode kretanja Narrower term(s) J Euro Voc Classification K intra-EU mobility HU szabad mozgáshoz való jog IT diritto di libera circolazione 1011 European Union law| 1236 rights and freedoms LT laisvo judėjimo teisė MT Dritt għal-libertà tal-moviment / għall‑moviment bla xkiel / għall-merħ ħieles NL recht op vrij verkeer PL prawo do swobodnego przepływu PT direito de livre circulação RO dreptul la liberă circulaţie SK právo na slobodný pohyb / právo na voľný pohyb SL pravica do prostega gibanja SV rätt till fri rörlighet NO rett til fri bevegelse (b); rett til fri rørsle (n) KA თავისუფალი გადაადგილების უფლება UK право на свободу пересування HY ազատ տեղաշարժի իրավունք L Note(s) LV tiesības brīvi pārvietoties H 1. The right to free movement is one of the basic rights of EU citizens which was initially one of the founding rights in the establishment of the European Union and enshrined in Art. 21(1) of TFEU; it has been developed by EU secondary legislation and the case law of the Court of Justice of the European Union (CJEU). 2. Free movement of workers also applies to the countries in the European Economic Area (IS, LI, NO) and to CH. 3. The provisions of the treaties in relation to freedom of movement apply in the same way to the ten EU Member States that joined the EU in 2004, BG and RO that joined in January 2007 and HR, which joined in July 2013. Some of the original EU Member States (before May 2004) apply transitional agreements that currently restrict freedom of movement to workers for a certain time period (see the description of freedom of movement on the European Citizens’ Information website). 4. Freedom of movement and residence are granted, in accordance with the Treaty establishing the European Community, only for certain categories of third-country nationals, i.e. long-term residents, highly-skilled workers, researchers and students. Whilst third-country nationals who hold a valid residence permit or visa have the right to move freely within the Schengen area for up to three months within a six-month period, the rights in relation to taking up residence for a period exceeding three months in another EU Member State are covered by specific legal instruments, depending on their status, and subject to conditions in national legislation. M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 519
risk of absconding BG опасност от укриване CS nebezpečí útěku DE Fluchtgefahr / Gefahr, unterzutauchen EL κίνδυνος διαφυγής EN risk of absconding ES riesgo de fuga Definition(s) In the EU context, existence of reasons in an individual case which are based on objective criteria defined by law to believe that a third-country national who is subject to return procedures may abscond. Source(s) FI pakenemisen vaara Art. 3(7) of Directive 2008/115/EC (Return Directive) and Art. 2(n) of Regulation (EU) No 604/2013 (Dublin III Regulation) FR risque de fuite Broader term(s) ET põgenemise / kõrvalehoidumise oht GA baol éalaithe HR rizik od bijega HU szökés veszélye IT rischio di fuga LT pasislėpimo pavojus LV bēgšanas iespējamība absconding Euro Voc Classification 2811 migration Note(s) This covers one type of absconding. MT Riskju / Biża’ ta’ ħarba / ħrib / kontumaċja NL risico op onderduiken PL ryzyko ucieczki PT perigo de fuga RO risc de sustragere /riscul de a se sustrage SK riziko úteku SL tveganje pobega / nevarnost pobega SV risk för avvikande NO risiko for unndragelse (b); risiko for unndraging (n) KA მიმალვის რისკი UK ризик втечі HY 520 արդարադատությունից խուսափելու ռիսկ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B safe country of origin BG сигурна страна на произход CS bezpečná země původu EL ασφαλής χώρα καταγωγής EN safe country of origin ES país de origen seguro ET turvaline päritoluriik FI turvallinen alkuperämaa FR pays d’origine sûr GA tír thionscnaimh atá sábháilte A country where, on the basis of the legal situation, the application of the law within a democratic system and the general political circumstances, it can be shown that there is generally and consistently no persecution as defined in Art. 9 of Directive 2011/95/EU (Recast Qualification Directive), no torture or inhuman or degrading treatment or punishment and no threat by reason of indiscriminate violence in situations of international or internal armed conflict. E Source(s) I HR sigurna zemlja podrijetla Annex 1 of Directive 2013/32/EU (Recast Asylum Procedures Directive) HU biztonságos származási ország Synonym(s) IT paese di origine sicuro concept of safe country of origin LT saugi kilmės šalis (EU acquis); saugi kilmės valstybė Broader term(s) LV droša izcelsmes valsts country of origin MT Pajjiż tal-oriġini sigur / bla perikli Related term(s) NL veilig land van herkomst safe third country PL bezpieczny kraj pochodzenia EMN Asylum and Migration Classification RO ţara de origine sigură SK bezpečná krajina pôvodu SL varna izvorna država SV säkert ursprungsland NO trygt hjemland (b); trygt heimland (n) KA უსაფრთხო წარმომავლობის (წარმოშობის) ქვეყანა UK безпечна країна походження HY անվտանգ ծագման երկիր D Definition(s) DE sicherer Herkunftsstaat PT país de origem seguro C F G H J K L M 4.1.1 Refugee protection| 6.2.5 Accelerated and other specific procedures N Euro Voc Classification O 1011 European Union law| 2811 migration P Note(s) 1. According to Art. 37 of Directive 2013/32/EU (Recast Asylum Procedures Directive), EU Member States may retain or introduce legislation that allows for the national designation of safe countries of origin for the purposes of examining applications for international protection. 2. According to the Protocol 29 of TFEU, EU Member States shall be regarded as constituting safe countries of origin in respect of each other for all legal and practical purposes in relation to asylum matters. Accordingly, any application for asylum made by a national of a Member State are normally not taken into consideration. 3. EU Member States shall regularly review the situation in third countries that are designated as safe countries of origin. 4. The assessment of whether a country is a safe country of origin shall be based on a range of sources of information, including in particular information from other EU Member States, European Union Agency for Asylum (EUAA), United Nations High Commissioner for Refugees (UNHCR), the Council of Europe and other relevant international organisations. 5. According to Art. 36 of Directive 2013/32/EU, the ‘concept of safe country of origin’ means that a third country is - after an individual examination of the application - considered as a safe country of origin for a particular applicant only if: ƒ they have the nationality of that country; or ƒ they are a stateless person and were formerly habitually resident in that country, ƒ and they have not submitted any serious grounds for considering the country not to be a safe country of origin in their particular circumstances and in terms of their qualification as a beneficiary of international protection in accordance with Directive 2011/95/EU (Recast Qualification Directive). EMN ASYLUM AND MIGRATION GLOSSARY 10.0 521 Q R S T U V W X Y Z
safe third country BG сигурна трета страна CS bezpečná třetí země DE sicherer Drittstaat EL ασφαλής τρίτη χώρα EN safe third country ES tercer país seguro ET turvaline kolmas riik FI turvallinen kolmas maa FR pays tiers sûr GA tríú tír atá sábháilte HR sigurna treća zemlja HU biztonságos harmadik ország IT paese terzo sicuro LT saugi trečioji šalis (EU acquis); saugi trečioji valstybė LV droša trešā valsts MT Pajjiż terz sigur / bla perikli NL veilig derde land PL bezpieczny kraj trzeci PT país terceiro seguro RO ţară terţă sigură SK bezpečná tretia krajina SL varna tretja država SV säkert tredjeland NO trygt tredjeland KA უსაფრთხო მესამე ქვეყანა Definition(s) A third country that treats a person seeking international protection in accordance with accepted international standards, in particular: (a) life and liberty are not threatened on account of race, religion, nationality, membership of a particular social group or political opinion; (b) there is no risk of serious harm as defined in Directive 2011/95/EU (Recast Qualification Directive); (c) the principle of non-refoulement in accordance with the Geneva Refugee Convention and Protocol is respected; (d) the prohibition of removal, in violation of the right to freedom from torture and cruel, inhuman or degrading treatment as laid down in international law, is respected; and (e) the possibility exists to request refugee status and, if found to be a refugee, to receive protection in accordance with the Geneva Refugee Convention and Protocol. Source(s) Derived by EMN from Art. 38 of Directive 2013/32/EU (Recast Asylum Procedures Directive) Broader term(s) third country Related term(s) safe country of origin EMN Asylum and Migration Classification UK безпечна третя країна 4.1 International protection| 6.2.5 Accelerated and other specific procedures HY Euro Voc Classification անվտանգ երրորդ երկիր 1011 European Union law| 2811 migration 522 EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B Schengen Agreement BG Шенгенско споразумение CS Schengenská dohoda C D Definition(s) ES Acuerdo de Schengen An agreement between some EU Member States and some neighbouring non-Member States to gradually remove controls at their common borders and introduce freedom of movement for all nationals of the signatory Member States, other EU Member States or third countries. ET Schengeni leping Source(s) DE Schengener Übereinkommen EL Συμφωνία Σένγκεν EN Schengen Agreement FI Schengenin sopimus Derived by EMN from the Schengen Agreement FR accord de Schengen Related term(s) GA Comhaontú Schengen HR Schengenski sporazum HU Schengeni Megállapodás IT Accordo di Schengen LT Šengeno susitarimas LV Šengenas nolīgums MT Ftehim (Il-) ta’ Schengen NL Schengenakkoord PL Układ z Schengen PT Acordo de Schengen RO Acordul Schengen SK Schengenská dohoda SL Schengenski sporazum SV Schengenavtalet NO Schengen-avtalen F G H I Schengen Borders Code Schengen Convention Schengen Information System (SIS) J EMN Asylum and Migration Classification K Euro Voc Classification L 6.1.1 Border control| 6.1.3 Schengen governance 1011 European Union law| 2811 migration M Note(s) 1. The Schengen Agreement was signed on 14 June 1985 between BE, FR, DE, LU and NL. 2. The Agreement and the Convention, the rules adopted on that basis and the related agreements together form the ‘Schengen acquis’. Since 1999, this has formed part of the institutional and legal framework of the European Union by virtue of a protocol to the Treaty of Amsterdam. 3. The rules governing the movement of persons across borders are set out in Regulation (EU) 2016/399 (Schengen Borders Code). 4. For more information, see the website of the European Commission on Schengen . KA შენგენის შეთანხმება N O P Q R UK Шенгенська угода HY E Շենգենյան համաձայնագիր S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 523
Schengen Borders Code BG Шенгенски граничен кодекс CS Schengenský hraniční kodex Definition(s) DE Schengener Grenzkodex The rules governing border control of persons crossing the external EU borders of the EU Member States. EL Κώδικας Συνόρων Σένγκεν Source(s) EN Schengen Borders Code ES Código de fronteras Schengen ET Schengeni piirieeskirjad Derived by the EMN from Regulation (EU) 2016/399 (Schengen Borders Code) Related term(s) LT Šengeno sienų kodeksas border control external EU border internal EU border irregular entry legal entry refusal of entry Schengen Agreement Schengen Information System (SIS) LV Šengenas Robežu kodekss EMN Asylum and Migration Classification FI Schengenin rajasäännöstö FR code frontières Schengen GA Cód Teorainneacha Schengen HR Zakonik o schengenskim granicama HU Schengeni határ-ellenőrzési kódex IT Codice Frontiere Schengen MT Kodiċi tal-Fruntieri / tal-Konfini ta’ Schengen 6.1.1 Border control| 6.1.3 Schengen governance NL Schengengrenscode Euro Voc Classification PL kodeks graniczny Schengen 1011 European Union law| 2811 migration PT Código das Fronteiras Schengen RO Codul Frontierelor Schengen SK Kódex schengenských hraníc SL Zakonik o schengenskih mejah SV kodex om Schengengränserna NO Schengen-regelverket KA შენგენის სასაზღვრო კოდექსი UK Шенгенський прикордонний кодекс HY 524 Շենգենյան Սահմանային Օրենսգիրք EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B Schengen Convention BG Шенгенска конвенция C D Definition(s) CS Schengenská prováděcí úmluva E Legislation supplementing the Schengen Agreement and laying down the arrangements and safeguards for implementing freedom of movement. DE Schengener Durchführungsübereinkommen EL Συνθήκη Σένγκεν F Source(s) EN Schengen Convention Derived by EMN from the Schengen acquis ES Convenio de Schengen G Synonym(s) ET Schengeni konventsioon H Convention implementing the Schengen Agreement FI Schengenin yleissopimus Related term(s) FR convention de Schengen I Schengen Agreement Schengen Borders Code Schengen Information System (SIS) GA Coinbhinsiún Schengen HR Schengenska konvencija HU Schengeni Egyezmény J EMN Asylum and Migration Classification IT Convenzione di Schengen K 6.1.1 Border control| 6.1.3 Schengen governance LT Šengeno konvencija Euro Voc Classification LV Šengenas konvencija L 1011 European Union law| 2811 migration MT Konvenzjoni (il-) ta’ Schengen M NL Schengenverdrag / Schengenuitvoeringsovereenkomst PL Konwencja Wykonawcza do Układu z Schengen N PT Convenção de Schengen RO Convenţia Schengen O SK Schengenský dohovor SL Schengenska konvencija P SV Schengenkonventionen NO Schengen-konvensjonen Q KA შენგენის კონვენცია R UK Шенгенська конвенція HY Շենգենյան կոնվենցիա S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 525
Schengen evaluation and monitoring mechanism BG механизъм за оценка и наблюдение на Шенген CS Schengenský evaluační a monitorovací mechanismus DE Schengen-Evaluierungs- und Überwachungsmechanismus / Schengener Evaluierungs- und Überwachungsmechanismus EL μηχανισμός παρακολούθησης και αξιολόγησης Σένγκεν EN Schengen evaluation and monitoring mechanism ES Mecanismo de evaluación y seguimiento de Schengen ET Schengeni hindamis - ja järelevalvemehhanism FI Schengenin säännöstön soveltamisen varmistamisen arviointi- ja valvontamekanismi FR mécanisme d’évaluation et de contrôle destiné à vérifier l’application de l’acquis de Schengen GA meicníocht meastóireachta agus monatóireachta Schengen Definition(s) A mechanism established to verify the application of the Schengen acquis in the Schengen Member States to which it applies in full as well as in Schengen Member States to which, in accordance with the relevant Protocols annexed to the TEU and to the TFEU, the Schengen acquis applies in part to ensure an effective, consistent and transparent application of the Schengen rules and regulations while at the same time maintaining a high level of mutual trust between those Member States. Source(s) Derived by EMN from Art. 1 of Council Regulation (EU) No 1053/2013 (Schengen Evaluation Regulation) and Description of the Schengen evaluation and monitoring on the website of DG Migration and Home Affairs Related term(s) HR Mehanizam evaluacije i praćenja za provjeru primjene schengenske pravne stečevine Schengen Information System (SIS) HU schengeni értékelési és nyomonkövetési mechanizmus 6.1.1 Border control| 6.1.3 Schengen governance IT meccanismo di valutazione e di controllo per verificare l’applicazione dell’acquis di Schengen LT Šengeno vertinimo ir stebėsenos mechanizmas LV Šengenas izvērtēšanas un uzraudzības mehānisms MT Mekkaniżmu (Il-) Schengen t’ evalwazzjoni u monitoraġġ NL Schengenevaluatie- en toezichtmechanisme PL mechanizmu oceny i monitorowania w celu weryfikacji stosowania dorobku Schengen PT mecanismo de avaliação e monitorização Schengen RO Mecanismului de evaluare și monitorizare Schengen SK Schengenský mechanizmus hodnotenia a monitorovania EMN Asylum and Migration Classification Euro Voc Classification 1011 European Union law| 2811 migration Note(s) 1. According to Art. 4 of the Regulation the mechanism covers all aspects of the Schengen acquis, including external EU borders, visa policy, the Schengen Information System (SIS), data protection, police cooperation, judicial cooperation in criminal matters, as well as the absence of border control at the internal EU borders and the functioning of the authorities applying the relevant parts of the Schengen acquis. It introduces the possibility to carry out unannounced on-site visits and gives clearer rules for the set up and adoption of evaluation reports and recommendations, as well as for the follow-up of identified deficiencies in Schengen Member State’s external border control. 2. The European Commission is responsible for the overall organisation and implementation of the mechanism in close cooperation with the Schengen Member States. SL Schengenski ocenjevalni in spremljevalni mehanizem SV utvärderings- och övervakningsmekanism för Schengen NO Evalueringsmekanisme for Schengen KA შენგენის შეფასებისა და მონიტორინგის მექანიზმი UK Шенгенський механізм оцінки і спостереження HY 526 Շենգենյան գնահատման և մոնիտորինգի մեխանիզմ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B Schengen Information System (SIS) BG Шенгенска информационна система CS Schengenský informační systém DE Schengener Informationssystem EL Σύστημα Πληροφοριών Σένγκεν EN Schengen Information System (SIS) ES Sistema de Información de Schengen ET Schengeni infosüsteem FI Schengenin tietojärjestelmä FR Système d’information Schengen (SIS) GA Córas Faisnéise Schengen HR Schengenski informacijski sustav (SIS) HU Schengeni Információs Rendszer IT Sistema di Informazione Schengen LT Šengeno informacinė sistema LV Šengenas informācijas sistēma MT Sistema (Is-) ta’ Informazzjoni Schengen NL Schengeninformatiesysteem PL System Informacji Schengen A joint information system that enables the relevant authorities in each EU Member State, by means of an automated search procedure, to have access to alerts on persons and property for the purposes of border checks and other police and customs checks carried out within the country in accordance with national law and, for some specific categories of alerts (Art. 96 of the Schengen acquis), for the purposes of issuing visas, residence permits and the administration of legislation on aliens in the context of the application of the provisions of the Schengen Convention relating to the movement of persons. I L M Related term(s) 6.1.1 Border control| 6.1.3 Schengen governance SV Schengens informationssystem Euro Voc Classification Շենգենյան տեղեկատվական համակարգ H K second-generation Schengen Information System SIS SIS II SL Schengenski informacijski sistem HY G Synonym(s) EMN Asylum and Migration Classification UK Шенгенська інформаційна система (SIS) F J Derived by EMN from the Schengen acquis SK Schengenský informačný systém (SIS) KA შენგენის საინფორმაციო სისტემა (SIS) E Source(s) RO Sistemul de Informaţii Schengen NO Schengen informasjonssystem D Definition(s) Schengen Agreement Schengen Convention Schengen Borders Code PT Sistema de Informação de Schengen C N O P 1011 European Union law| 2811 migration Q Note(s) R The second-generation Schengen Information System (SIS II) was launched in April 2013 with enhanced functionalities, such as the possibility to use biometrics, new types of alerts, the possibility to link different alerts (such as an alert on a person and a vehicle) and a facility for direct queries on the system. SIS II also contains copies of European arrest warrants (EAW), which are recognised as having the same legal value as the originals, making it easier and quicker for the competent authorities to ensure the necessary follow-up. For more information, see the DG Migration and Home Affairs e-Library Glossary S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 527
school pupil BG ученик CS žák DE Schüler EL μαθητής σχολείου EN school pupil ES escolar ET kooliõpilane FI oppilas FR élève GA dalta scoile Definition(s) In the context of migration, a third-country national who is admitted to the territory of an EU Member tate to follow a recognised, state or regional programme of secondary education equivalent to level 2 or 3 of the International Standard Classification of Education, in the context of a pupil exchange scheme or educational project operated by an education establishment in accordance with national law or administrative practice. Source(s) HR učenik Art. 3(4) of Directive (EU) 2016/801 (Recast Students Directive) HU iskolai tanuló Related term(s) LT mokinys researcher student LV skolēns EMN Asylum and Migration Classification IT alunno MT Tifel (Tifla) tal-iskola NL scholier / leerling PL uczeń PT aluno 3.3 Migration for Study and Research Euro Voc Classification 1011 European Union law| 2811 migration| 3206 education RO elev SK žiak SL učenec / šolar SV elev NO skoleelev (b) / skuleelev (n) KA სკოლის მოსწავლე UK школяр HY 528 աշակերտ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B search and rescue (SAR) operation BG операция за търсене и спасяване C D Definition(s) CS pátrací a záchranná operace DE Such- und Rettungseinsatz EL επιχείρηση έρευνας και διάσωσης (SAR) EN search and rescue (SAR) operation ES Operación de búsqueda y captura ET otsingu- ja päästeoperatsioon FI meripelastusoperaatio FR opération de recherche et de sauvetage GA Oibríocht cuardaigh agus tarrthála HR operacija traganja i spašavanja osoba u pogibeli na moru In the global context, operation to render assistance to persons in distress at sea regardless of the nationality or status of such a person or the circumstances in which that person is found in accordance with the applicable Maritime Law and Conventions. In the EU context, operation of EU Member States to render assistance to any vessel or person in distress at sea regardless of the nationality or status of such a person or the circumstances in which that person is found in accordance with international law and respect for fundamental rights. E Source(s) J MT Operazzjoni ta’ Tiftix u Salvataġġ Global context: Voluntary Code of Conduct for Search and Rescue Operations undertaken by civil society NonGovernmental Organisations in the Mediterranean Sea, 2017 EU-context: Art. 9 of Regulation (EU) No 656/2014 (Regulation on rules for the surveillance of the external sea borders NL opsporings- en reddingsoperatie Synonym(s) HU kutatási és mentési művelet IT operazione di ricerca e soccorso LT paieškos ir gelbėjimo operacija LV meklēšanas un glābšanas operācija SAR operation PL Operacja poszukiwawczo-ratownicza RO operațiune de căutare și de salvare SK pátracia a záchranná operácia / pátracia a záchranná činnosť SL operacija iskanja in reševanja SV sök- och räddningsinsats UK пошуково-рятувальна операція (SAR) HY որոնման և փրկարար գործողություն H I K L M 4. International Protection and other Types of Protection| 6.2.1 Access to the international protection procedure O Euro Voc Classification P 1011 European Union law| 1231 international law| 2811 migration| 7606 United Nations| 7621 World Organisations Q NO Lete og redningsoperasjon KA საძიებო-სამაშველო (SAR) ოპერაცია G N EMN Asylum and Migration Classification PT operação de busca e salvamento F R Note(s) 1. SAR services inside the Convention are defined as: “The performance of distress monitoring, communication, co-ordination and search and rescue functions, including provision of medical advice, initial medical assistance, or medical evacuation, through the use of public and private resources including co-operating aircraft, vessels and other crafts and installations”. 2. Civil society-led Non-Governmental Organisations (NGOs) engaged in SAR operations have published voluntary minimum standards intended to ƒ ensure that their actions are conducted in support of the fundamental right to life with dignity, the right to receive humanitarian assistance in protection of life and the right to personal protection and security for all persons in distress at sea based on legal requirements of established international maritime law; ƒ enhance joint co-ordination and co-operation of SAR operations in the Mediterranean region with as many stakeholders as possible, including established Rescue Coordination Centres, European institutions, Agencies, shipping and fishing associations and military forces (for further information see: Voluntary Code of Conduct for Search and Rescue operations undertaken by civil society NGOs in the Mediterranean Sea, First Edition, February 2017). 3. For further information on relevant legal provisions and on practical procedures to ensure the prompt disembarkation of survivors of rescue operations see International Maritime Organisation (IMO) and United Nations High Commissoner for Refugees: Rescue at sea: a guide to principles and practice as applied to migrants and refugees. EMN ASYLUM AND MIGRATION GLOSSARY 10.0 529 S T U V W X Y Z
seasonal worker BG сезонен работник CS sezónní pracovník DE Saisonarbeiter / Saisonarbeitnehmer EL εποχικά εργαζόμενος EN seasonal worker ES trabajador de temporada extranjero ET hooajaline (võõr)töötaja FI kausityöntekijä FR travailleur saisonnier GA oibrí séasúrach HR sezonski radnik HU idénymunkás IT lavoratore stagionale LT sezoninis darbuotojas Definition(s) A third-country national who retains their principal place of residence in a third country and stays legally and temporarily in the territory of an EU Member State to carry out an activity dependent on the passing of the seasons, under one or more fixed-term work contracts concluded directly between that third-country national and the employer established in that EU Member State. Source(s) Art. 3 of Directive 2014/36/EU (Seasonal Workers’ Directive) Synonym(s) seasonal migrant seasonal worker migrant Related term(s) LV sezonas darbinieks circular migration contract migrant worker MT Ħaddiem staġjonali / tal-istaġun EMN Asylum and Migration Classification NL buitenlandse seizoensarbeider PL pracownik sezonowy PT trabalhador migrante sazonal RO lucrător sezonier / muncitor sezonier SK sezónny zamestnanec / sezónny pracovník SL sezonski delavec SV säsongsarbetare NO sesongarbeider (b); sesongarbeidar (n) 3.1 Migration for Economic Purposes Euro Voc Classification 1011 European Union law| 2811 migration| 4406 employment Note(s) This term is specifically referring to a third-country national, although it is known that other types of seasonal workers exist, e.g. for nationals within the same country, as well as intra-EU seasonal workers. KA სეზონური მუშაკი UK сезонний працівник HY 530 սեզոնային աշխատող EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B secondary movement of migrants BG вторично движение на мигранти C D Definition(s) CS druhotný pohyb migrantů E The movement of migrants, including refugees and asylum seekers, who for different reasons move from the country in which they first arrived to seek protection or permanent resettlement elsewhere. DE Sekundärmigration EL δευτερογενής μετακίνηση μεταναστών EN secondary movement of migrants ES movimientos migratorios secundarios F G Source(s) ET sisserändajate teisene (riikidevaheline) liikumine FI maahanmuuttajien toissijainen siirtyminen Derived by EMN from UNHCR Executive Committee (ExCom): Conclusion No 58 (1989) FR mouvement secondaire de migrants Synonym(s) H irregular secondary movement of migrants secondary migrant secondary movement of asylum seekers and refugees GA athghluaiseacht imirceach HR sekundarno kretanje migranata HU másodlagos migrációs mozgás I J IT movimento secondario di migranti Broader term(s) LT antrinis migrantų judėjimas (EU acquis); migrantų pakartotinis judėjimas K Narrower term(s) LV migrantu tālāka pārvietošanās asylum shopping L MT Moviment sekondarju ta’ migranti EMN Asylum and Migration Classification M irregular migration NL secundaire migratiestroom PL wtórny przepływ migrantów/wtórne przemieszczanie się migrantów PT movimento secundário de migrantes RO mişcare secundară a migranţilor SK sekundárny pohyb migrantov SL sekundarno gibanje migrantov SV sekundär migration NO sekundærmigrasjon KA მიგრანტების განმეორებითი გადაადგილება UK вторинне переміщення мігрантів HY միգրանտների երկրորդային տեղաշարժ 4.1 International protection| 13. Irregular Migration| 14. Factors and Impacts of Migration Euro Voc Classification N 2811 migration O Note(s) P 1.This movement is without the prior consent of the national authorities, it can be with (legal entry but then stay beyond the allowed duration) or without an entry visa; it can be with or with no or insufficient documentation normally required for travel purposes, or with false or fraudulent documentation. 2. In the European Union, the Dublin III Regulation (Regulation (EU) No 604/2013) aims at avoiding secondary movement of applicants for international protection between different EU/EFTA Member States. Art. 3(1) of the Regulation establishes that an application for international protection should be examined by a single EU Member State, to be determined under the responsibility criteria as set out in Chapter III of the same Regulation. Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 531
second-generation migrant BG второ поколение мигрант CS migrant druhé generace DE Migrant der zweiten Generation EL μετανάστης δεύτερης γενιάς EN second-generation migrant ES migrante de segunda generación ET teise põlvkonna sisserändaja FI toisen polven maahanmuuttaja FR migrant de la deuxième génération GA imirceach den dara glúin HR migrant druge generacije HU második generációs migráns IT migrante di seconda generazione LT antros kartos migrantas Definition(s) A person who was born in and is residing in a country that at least one of their parents previously entered as a migrant. Source(s) Developed by EMN Synonym(s) second-generation immigrant Broader term(s) person with a migratory background Related term(s) first-generation migrant third-generation migrant EMN Asylum and Migration Classification LV otrās paaudzes migrants 1. Framework Concepts on Migration (including root causes of migration| 7.3 Families MT migrant tat-tieni ġenerazzjoni Euro Voc Classification NL tweede generatie allochtoon / tweede generatie migrant PL migrant drugiego pokolenia PT migrante de segunda geração RO migrant a doua generaţie SK migrant druhej generácie SL migrant druge generacije SV andra generationens invandrare NO person med to innvandrerforeldre (b); person med to innvandrarforeldre (n) KA მეორე თაობის მიგრანტი UK мігрант у другому поколінні HY 532 2811 migration Note(s) 1. This term is not defined in legislation but has a more sociological context; a broad defintion encompassing the concept of a ‘second-generation migrant’ has been used. Strictly this term does not relate to a migrant, since the person concerned has not undertaken a migration, but the term is included as it is commonly used in publications and the media. 2. According to the Recommendations for the 2010 Censuses of Population and Housing, the group referred to as ‘second-generation’ is generally restricted to those persons whose parents were born abroad, whereas those persons having one parent born in the country and the other one born abroad represent a special case (they form the group of persons with a mixed background). As explained in 1. above, a broader definition was considered more appropriate for the work of the EMN. երկրորդ սերնդի միգրանտ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B segregation BG сегрегация CS segregace DE Segregation EL διαχωρισμός EN segregation ES segregación C D Definition(s) The act by which a (natural or legal) person separates other persons on the basis of race, colour, language, religion, nationality or national or ethnic origin without an objective and reasonable justification. E Source(s) G FI segregaatio European Commission against Racism and Intolerance (ECRI): General Policy Recommendation No 7: National legislation to combat racism and racial discrimination FR ségrégation Broader term(s) ET segregatsioon HR segregacija discrimination racial discrimination HU szegregáció EMN Asylum and Migration Classification GA deighilt J LV segregācija MT segregazzjoni Euro Voc Classification LT segregacija NL segregatie PL segregacja K L M 1236 rights and freedoms| 7611 European Organisations N PT segregação RO segregare O SK segregácia SL segregacija P SV segregation NO segregering Q KA სეგრეგაცია R UK сегрегація HY H I 1. Framework Concepts on Migration (including root causes of migration| 9. Integration| 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) IT segregazione F բաժանում S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 533
self-employed person BG самонаето лице CS osoba samostatně výdělečně činná (OSVČ) DE Selbstständiger EL αυτοαπασχολούμενος EN self-employed person ES trabajador por cuanta propia ET füüsilisest isikust ettevõtja FI itsenäinen ammatinharjoittaja FR travailleur indépendant Definition(s) A person who is the sole or joint owner of the unincorporated enterprise (one that has not been incorporated, i.e. formed into a legal corporation) in which they work, unless they are also in paid employment which is their main activity. Source(s) Eurostat’s Concepts and Definitions Database Related term(s) GA duine féinfhostaithe employee employer HR samozaposlena osoba EMN Asylum and Migration Classification HU önálló vállalkozó IT lavoratore autonomo LT savarankiškai dirbantis asmuo LV pašnodarbināta persona MT persuna taħdem għal rasha / persuna b’impjieg indipendenti NL zelfstandige PL osoba samozatrudniona PT trabalhador por conta própria RO lucrător independent 3.1 Migration for Economic Purposes Euro Voc Classification 4406 employment Note(s) 1. In the last case, they are considered to be employees. 2. According to ILO’s ICSE-93, self-employment jobs are those jobs where the remuneration is directly dependent upon the profits (or the potential for profits) derived from the goods and services produced (where own consumption is considered to be part of the profits). The incumbents make the operational decisions affecting the enterprise, or delegate such decisions while retaining responsibility for the welfare of the enterprise. (In this context, ‘enterprise’ includes one-person operations.) SK samostatne zárobkovo činná osoba (SZČO) SL samozaposlena oseba SV egenföretagare NO selvstendig sysselsatt (b); sjølvstendig sysselsett (n) KA თვითდასაქმებული UK самозайнята особа HY 534 ինքնազբաղ աշխատող EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B separated child BG отделено дете CS odloučené dítě DE alleinstehendes Kind EL παιδί χωρισμένο από την οικογένειά του EN separated child ES menor separado C D Definition(s) A child under 18 years of age who is outside their country of origin and separated from both parents or their previous legal / customary primary caregiver. E Source(s) G F FR enfant séparé Art. 8 of UN Committee on the Rights of the Child, General Comment No 6 (2005) and Fundamental Rights Agency (FRA): Study on separated, asylum seeking children in EU Member States, 2010 GA páiste dealaithe Broader term(s) ET vanematest eraldatud laps FI huoltajasta erilleen joutunut lapsi HR dijete odvojeno od roditelja child HU elszakított gyermek Narrower term(s) IT minore separato LT atskirtas nuo tėvų vaikas LV bez vecāku vai aizbildņu gādības palicis bērns / no vecākiem nošķirts bērns MT tifel mifrud NL alleenstaand kind PL dziecko odseparowane PT criança separada RO copil separat SK odlúčené dieťa I J unaccompanied minor K EMN Asylum and Migration Classification 4.1 International protection| 7.2 Minors and unaccompanied minors L Euro Voc Classification M 2811 migration| 7606 United Nations N Note(s) A child may be totally alone while another may be living with extended family members. All such children are separated children and entitled to international protection under a broad range of international and regional instruments. SL otrok, ločen od staršev ali skrbnikov SV separerat barn O P Q NO enslig barn (b); einsleg barn (n) KA განცალკევებული ბავშვი R UK дитина, розлучена із сім’єю HY H S ընտանիքից բաժանված երեխա T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 535
serious harm BG тежки посегателства CS vážná újma DE ernsthafter Schaden EL σοβαρή βλάβη EN serious harm ES daños graves ET tõsine oht / kahju FI vakava haitta FR atteinte grave Definition(s) Harm consisting of (a) the death penalty or execution; or (b) torture or inhuman or degrading treatment or punishment of an applicant in the country of origin; or (c) serious and individual threat to a civilian’s life or person by reason of indiscriminate violence in situations of international or internal armed conflict. Source(s) GA díobháil thromchúiseach Art. 15 of Directive 2011/95/EU (Recast Qualification Directive) HR ozbiljna nepravda Narrower term(s) HU súlyos sérelem real risk of suffering serious harm IT danno grave Related term(s) LT didelė žala LV smags kaitējums MT Dannu(-i) serju(-i) NL ernstige schade PL poważna krzywda PT ofensas graves RO vătămare gravă SK vážne bezprávie degrading treatment or punishment inhuman treatment or punishment persecution torture EMN Asylum and Migration Classification 4.1.2 Subsidiary protection Euro Voc Classification 1011 European Union law| 2811 migration SL resna škoda SV allvarlig skada NO alvorlig skade (b); alvorleg skade (n) KA სერიოზული ზიანი UK серйозна шкода HY 536 լուրջ վնաս EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B sex BG пол CS pohlaví C D Definition(s) DE biologisches Geschlecht The biological characteristics of a person, predominantly female or male. E EL φύλο Source(s) F EN sex ES sexo ET sugu FI sukupuoli (biologinen) FR sexe GA gnéas HR spol Derived by EMN from the Gender Equality Glossary of the UN Women Website European Institute for Gender Equality’s (EIGE) Gender Equality Glossary & Thesaurus Related term(s) gender G H I EMN Asylum and Migration Classification HU (biológiai) nem 1. Framework Concepts on Migration (including root causes of migration J IT sesso Euro Voc Classification K LT lytis 2816 demography and population L LV dzimums MT Sess M NL sekse / geslacht PL płeć N PT sexo RO sex O SK pohlavie SL spol P SV kön NO kjønn Q KA სქესი R UK стать HY սեռ S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 537
sexual orientation BG сексуална ориентация CS sexuální orientace DE sexuelle Orientierung EL σεξουαλικός προσανατολισμός EN sexual orientation ES Definition(s) Each person’s profound emotional, affectional and sexual attraction to, and intimate and/or sexual relations with, individuals of a different gender or the same gender or more than one gender. Source(s) FI seksuaalinen suuntautuminen Yogyakarta principles on the application of international human rights law in relation to sexual orientation and gender identity, March 2006. FR orientation sexuelle Related term(s) ET seksuaalne sättumus GA gnéaschlaonadh gender identity HR seksualna orijentacija EMN Asylum and Migration Classification HU szexuális irányultság IT orientamento sessuale LT seksualinė orientacija LV seksuālā orientācija MT Orjentament sesswali NL seksuele gerichtheid / seksuele oriëntatie PL orientacja seksualna PT orientação sexual RO SK sexuálna orientácia SL spolna usmerjenost SV sexuell läggning NO seksuell orientering/legning KA სექსუალური ორიენტაცია UK сексуальна орієнтація HY 538 սեռական կողմնորոշում 1. Framework Concepts on Migration (including root causes of migration| 7. Vulnerable Groups Euro Voc Classification 1236 rights and freedoms Note(s) 1. The Yogyakarta Principles, adopted in 2006, are a set of principles on the application of international human rights law in relation to sexual orientation and gender identity. Principle 23 includes the right to asylum. 2. In 2017 a set of new principles on in-ternational human rights law relating to sexual orientation, gender identity, gender expression and sex characteristics (SOGIESC) were added, among others the right to state protection: “Everyone, regardless of sexual orientation, gender identity, gender expression or sex charac-teristics, has the right to State protection from violence, discrimination and other harm, whether by government officials or by any individual or group”. For more in-formation see: The Yogyakarta Principles plus 10 (YP+10), 2017. 3. Sexual orientation can be a ground for protection under the Geneva Refugee Convention and Protocol and under EU international protection legislation. 4. Art. 10 of Directive 2011/95/EU (Recast Qualification Directive) explicitly includes sexual orientation and gender identity among the possible reasons for persecution, both should be given due consideration when determining whether a person belongs to a particular social group under persecution. 5. According to Art. 18(3) of Directive 2031/33/EU (Recast Reception Conditions Directive) EU Member States must take into consideration gender concerns and the specific needs of vulnerable persons such as LGBTI people within the premises and accommodation centres. Additionally, they are required to take appropriate measures to prevent assault and gender-specific violence, including sexual assault and harassment into considerations in reception. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B short-stay visa BG виза за краткосрочно пребиваване CS krátkodobé vízum DE Visum für den kurzfristigen Aufenthalt EL θεώρηση βραχείας διαμονής EN short-stay visa ES visado para estancia de corta duración ET lühiajaline viisa FI lyhytaikainen viisumi FR visa de court séjour GA víosa gearrchuairte HR kratkotrajna viza HU rövid távú tartózkodásra jogosító vízum IT visto per soggiorno di breve durata LT trumpalaikė viza LV īstermiņa vīza MT Viża ghal żjara / waqfa qasira // għal ftit taż-żmien NL visum voor kort verblijf PL wiza krótkoterminowa PT visto de curta duração RO viză de scurtă şedere SK krátkodobé vízum C D Definition(s) The authorisation or decision of an EU Member State with a view to transit through or an intended stay on the territory of one or more or all the EU Member States of a duration of no more than 90 days in any 180-day period. Source(s) Art. 2(2) of Regulation (EU) No 610/2013 (Visa Code Regulation) and Art. 2(m) of Regulation (EU) No 604/2013 (Dublin III Regulation) F G H I Synonym(s) J short-term visa transit visa K Broader term(s) visa L Related term(s) airport transit visa long-stay visa M EMN Asylum and Migration Classification 6.1.2 Visa policy| 6.1.3 Schengen governance N Euro Voc Classification O 1011 European Union law| 2811 migration SL vizum za kratkoročno prebivanje P SV visering för kortare vistelse NO besøksvisum Q KA მოკლევადიანი ვიზა R UK короткострокова віза HY E կարճատև կացության վիզա S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 539
short-term migrant BG краткосрочен мигрант CS krátkodobý migrant DE kurzfristig aufhältiger Migrant / kurzzeitig aufhältiger Migrant / Kurzzeit-Migrant EL μετανάστης βραχείας διαμονής EN short-term migrant ES persona migrante de carácter temporal ET lühiajaliselt riigis viibiv sisserändaja Definition(s) A person who moves to a country other than that of their usual residence for a period of at least three months but less than a year (12 months) except in cases where the movement to that country is for purposes of recreation, holiday, visits to friends or relatives, business, medical treatment or religious pilgrimage. Source(s) FR migrant de courte durée Derived by EMN from the UN Recommendations on Statistics of International Migration and OECD Glossary of Statistical Terms GA imirceach gearrthréimhseach Broader term(s) FI tilapäiseksi ajaksi muuttava henkilö HR stranac na kratkotrajnom boravku migrant HU rövid távú tartózkodási céllal érkező migráns Related term(s) IT migrante di breve periodo LT trumpalaikis migrantas LV īstermiņa migrants MT Migrant(a) għal żmien qasir / għal ftit żmien NL kortverblijvende migrant / kortdurig migrant PL migrant krótkookresowy PT migrante de curta duração RO migrant pe termen scurt SK krátkodobý migrant SL migrant za krajše obdobje SV korttidsmigrant emigrant immigrant long-term migrant temporary migration EMN Asylum and Migration Classification 3. Legal Migration Euro Voc Classification 2811 migration Note(s) For purposes of international migration statistics, the country of usual residence of short-term migrants is considered to be the country of destination during the period they spend in it. NO migrant med kortvarig opphold (b); migrant med kortvarig opphald (n) KA მოკლევადიანი მიგრანტი UK короткостроковий мігрант HY 540 կարճաժամկետ միգրանտ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B short-term migration BG краткосрочна миграция CS krátkodobá migrace DE kurzfristige Migration / kurzzeitige Migration / Kurzzeit-Migration EL βραχυπρόθεσμη μετανάστευση EN short-term migration ES migración de corta duración ET lühiajaline sisseränne Movement of individuals who change their country of usual residence for a period of at least three months but less than a year (12 months) except in cases where the movement to that country is for purposes of recreation, holiday, visits to friends or relatives, business, medical treatment or religious pilgrimage. Source(s) FR migration de courte durée GA imirce ghearrthréimhseach Broader term(s) HR kratkotrajne migracije migration HU rövid távú tartózkodási célú migráció Related term(s) IT migrazione di breve periodo LT trumpalaikė migracija LV īstermiņa migrācija MT Migrazzjoni ghal perjodu qasir NL kortetermijnmigratie PL migracja krótkookresowa PT migração de curta duração RO migraţie pe termen scurt D Definition(s) Derived by EMN from the UN Recommendations on Statistics of International Migration and OECD Glossary of Statistical Terms FI lyhytaikainen maahanmuutto C F G H I J K emigration immigration long-term migration temporary migration L M EMN Asylum and Migration Classification 3. Legal Migration N Euro Voc Classification 2811 migration O SK krátkodobá migrácia P SL migracije za krajše obdobje SV korttidsmigration Q NO korttidsmigrasjon KA მოკლევადიანი მიგრაცია R UK короткострокова міграція HY E S կարճաժամկետ միգրացիա T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 541
short-term mobility BG краткосрочна мобилност CS krátkodobá mobilita Definition(s) ES movilidad de corta duración In the context of Directive 2016/801/EU (Recast Researcher’s Directive), the right of a third-country national authorised to stay in the European Union for the purposes of research or studies to stay in one or several second EU Member States for a period of up to 180 days within a 360-day period in order to carry out part of their research in any research organisation. ET lühiajaline liikuvus Source(s) DE kurzfristige Mobilität / kurzzeitige Mobilität EL βραχυπρόθεσμη κινητικότητα (EL); βραχεία κινητικότητα (CY) EN short-term mobility FI lyhytaikainen liikkuvuus FR mobilité de courte durée GA soghluaisteacht ghearrthéarmach HR kratkoročna mobilnost HU rövid távú mobilitás IT Mobilità di breve durata LT trumpalaikis judumas LV īstermiņa mobilitāte Derived by EMN from Art. 28 of Directive 2016/801/EU (Recast Researchers’ Directive) Related term(s) long-term mobility EMN Asylum and Migration Classification 3.3 Migration for Study and Research Euro Voc Classification 1011 European Union law| 2811 migration MT Mobbiltà għal / perjodu / żmien qasir NL kortetermijnmobiliteit PL krótkoterminowa mobilność PT mobilidade de curto prazo RO SK krátkodobá mobilita SL kratkoročna mobilnost SV rörlighet för kortare vistelse NO kortsiktig flytting KA მოკლევადიანი მობილობა UK короткострокова мобільність HY 542 կարճաժամկետ շարժունակություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B single application procedure BG единна процедура за кандидатстване CS jednotný postup vyřizování žádostí DE einheitliches Antragsverfahren EL ενιαία διαδικασία υποβολής αίτησης EN single application procedure ES procedimiento único de solicitud ET ühtne taotlemismenetlus C D Definition(s) A procedure leading, on the basis of a single application made by a third-country national, or by their employer, for the authorisation of residence and work in the territory of a Member State, to a decision ruling on that application for the single permit. Source(s) FI yhden hakemuksen menettely Art. 2(d) of Directive 2011/98/EU (Single Permit Directive) FR procédure de demande unique Related term(s) E F G H I GA nós imeachta aoniarratais single permit HR jedinstveni postupak obrade zahtjeva za izdavanje jedinstvene dozvole za boravak i rad EMN Asylum and Migration Classification J HU összevont kérelmezési eljárás Euro Voc Classification K IT procedura unica di domanda 3. Legal Migration| 6. Migration Procedures 1011 European Union law| 2811 migration LT viena prašymų pateikimo procedūra L LV vienota pieteikšanās procedūra MT Proċedura ta’ applikazzjoni / talba waħda għal kull persuna M NL één enkele aanvraagprocedure N PL procedura jednolitego wniosku O PT procedimento de pedido único RO Procedură unică P SK jednotný postup vybavovania žiadostí SL enotni postopek za obravnavanje prošnje SV ett enda ansökningsförfarande Q NO samlet prosedyre om opphold og arbeid (b); samla prosedyre om opphald og arbeid (n) R KA ერთიანი განცხადების შეტანის პროცედურა S UK єдина процедура застосування HY միասնական դիմումի գործընթաց T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 543
single permit BG единно разрешение CS jednotné povolení DE kombinierte Erlaubnis EL ενιαία άδεια EN single permit ES permiso único Definition(s) A residence permit issued by the authorities of an EU Member State after a single application procedure allowing a third-country national to reside legally in its territory for the purpose of work. Source(s) ET ühtne luba Derived by EMN from Art. 2(d) of Directive 2011/98/EU (Single Permit Directive) FI yhdistelmälupa Broader term(s) FR permis unique GA ceadúnas aoniarratais HR jedinstvena dozvola za boravak i rad HU összevont engedély IT permesso unico LT vienas leidimas LV vienota atļauja MT Permess għal persuna waħda NL gecombineerde vergunning PL jednolite zezwolenie PT autorização única residence permit Related term(s) single application procedure EMN Asylum and Migration Classification 3. Legal Migration Euro Voc Classification 1011 European Union law| 2811 migration Note(s) A single permit is a combined title encompassing both residence and work permits within a single administrative act based on a common set of rights for third-country workers legally residing in an EU Member State. RO permis unic SK jednotné povolenie na pobyt a zamestnanie SL enotno dovoljenje SV kombinerat tillstånd NO samlet tillatelse (b); samla løyve (n) KA ერთიანი ნებართვა UK єдиний дозвіл HY 544 մեկանգամյա թույլտվություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B Sirene Bureau BG Бюрото SIRENE CS Centrála SIRENE DE Sirene-Büro EL Γραφείο SIRENE EN Sirene Bureau ES Servicio Nacional Sirene C An administrative structure built to deal with the exchange of information supplementary to the Schengen Information System (SIS) alerts among countries participating in the SIS. E Source(s) G ET SIRENE büroo Derived by EMN from section 1.1 of the Commission Implementing Decision (EU) 2015/219 FI SIRENE-toimisto Synonym(s) FR Bureau SIRENE HR Ured SIRENE SIRENE Supplementary Information Request at the National Entries Bureau HU SIRENE Iroda Broader term(s) GA Biúró Sirene IT Uffici SIRENE LT SIRENE biuras LV SIRENE birojs MT Uffiċċju Sirene NL Sirene-bureau PL Biuro SIRENE PT Gabinete SIRENE RO Biroul SIRENE SK Útvar SIRENE (EU acquis) / Ústredňa SIRENE D Definition(s) H I J Schengen Information System (SIS) K EMN Asylum and Migration Classification 6.1.3 Schengen governance L Euro Voc Classification 1011 European Union law| 2811 migration M Note(s) N Each state operating the SIS has set up a national SIRENE (Supplementary Information Request at the National Entries) Bureau, operational 24/7, that is responsible for any supplementary information exchange and coordination of activities connected to SIS alerts. SL Urad SIRENE O P SV Sirenekontor NO Sirenekontoret Q KA საირინის (Sirene) ბიურო R UK Бюро Sirene HY F SIRENE Բաժանմունք S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 545
Smart Borders Package BG Пакет интелигентни граници CS Soubor opatření týkající se inteligentních hranic Definition(s) FR paquet de mesures frontières intelligentes Set of measures consisting of the Entry/Exit System (EES), the European Travel Information and Authorisation System (ETIAS) and modifications to the Schengen Borders Code aimed at improving the management of the external EU borders by facilitating border crossings for pre-vetted frequent non-EU travellers, while at the same time fighting against irregular migration and improving internal security by stronger identification of persons at external EU/Schengen borders and detection of overstayers in the EU›s territory. GA an Pacáiste Teorainneacha Cliste Source(s) DE Maßnahmenpaket Intelligente Grenzen / Paket Intelligente Grenzen EL Δέσμη Μέτρων “Ευφυή Σύνορα” EN Smart Borders Package ES paquete de fronteras inteligentes ET arukate piiride pakett FI Älykkäät rajat-paketti LT Pažangaus sienų valdymo dokumentų rinkinys Derived by EMN from European Commission Communication on Stronger and Smarter Information Systems for Borders and Security, COM(2016) 205 final Derived by EMN from the Website of DG Migration and Home Affairs on Smart Borders LV viedrobežu tiesību aktu kopums Synonym(s) HR Paket o pametnim granicama HU Intelligens Határok Csomag IT pacchetto Frontiere intelligenti MT Pakkett ta’ Miżuri Tajbin għal Fruntieri / Konfini Smart NL Slimme Grenzen pakket PL Pakiet Inteligentne granice PT Pacote Fronteiras Inteligentes RO SK balík predpisov o inteligentných hraniciach / balík inteligentných hraníc SL Paket o pametnih mejah Smart Borders Stronger and Smarter Information Systems for Borders and Security Narrower term(s) Entry/Exit System (EES) European Travel Information and Authorisation System (ETIAS) Related term(s) UK Пакет «Інтелігентні кордони» Eurodac European Union Agency for Law Enforcement Cooperation (Europol) Schengen Information System (SIS) Visa Information System (VIS) HY EMN Asylum and Migration Classification SV Smart gränsförvaltning / Smarta gränser NO Pakke med tiltak for effektiv grensekontroll KA პაკეტი „ჭკვიანი საზღვრები“ Smart Borders միջոցառումների փաթեթ / սահմանների խելացի կառավարում 6.1.1 Border control Euro Voc Classification 1011 European Union law| 2811 migration Note(s) 1. The Smart Borders Package was proposed by the European Commission in February 2013. On 6 April 2016, the European Commission adopted a revised legislative proposal for Smart Borders, the regulations concerning the Smart Borders Package were adopted in 2017, Regulation (EU) 2017/2226 (Regulation establishing an Entry/Exit System (EES) and Regulation (EU) 2017/2225 amending Regulation (EU) 2016/399 as regards the use of the Entry/Exit System. 2. The information systems is managed by eu-LISA, the European Union Agency for the Operational Management of Large-Scale IT Systems in the Area of Freedom, Security and Justice. 3. For more information see the webpage of the European Commission on Smart Borders. 546 EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B smuggler BG контрабандист (на мигранти) CS převaděč DE Schleuser EL διακινητής EN smuggler ES ET inimsmugeldaja FI ihmissalakuljettaja FR passeur; trafiquant (de migrants) (FR) GA smuigléir daoine HR krijumčar HU csempész IT trafficante LT neteisėtai žmones gabenantis asmuo LV kontrabandists MT Kuntrabandist(a) NL mensensmokkelaar PL przemytnik C D Definition(s) In the migration context, person who procures, usually for financial, material or other gain, with little or no regard for migrants’ safety and wellbeing, the irregular entry of a migrant into a country of which they are neither nationals nor residents. Source(s) Derived by EMN from Art. 3 of UN Protocol against the Smuggling of Migrants by Land, Sea and Air, supplementing the UN Convention against Transnational Organised Crime Broader term(s) Related term(s) SL tihotapec SV människosmugglare NO menneskesmugler KA (სახელმწიფო) საზღვარზე მიგრანტთა უკანონოდ გადამყვანი UK особа, що займається незаконним ввезенням HY մաքսանենգ ճանապարհով միգրանտներ տեղափոխող անձ G H I K smuggling of migrants trafficking in human beings EMN Asylum and Migration Classification L Euro Voc Classification M 13.1 Migrant smuggling 2811 migration N Note(s) SK prevádzač F J facilitator PT contrabandista de pessoas RO E 1. Even though both terms are closely linked to each other and relate to the phenomenon of irregular migration, there is a difference between a smuggler and a facilitator. 2. Smuggler is the narrower concept and means a person who enables the transport of a person (with their consent) to another country through illegal means. A smuggler facilitates the irregular entry, in breach of immigration law, either clandestinely or through deception or the use of false documentation. This can result in a benefit for the smuggler. The person smuggled will be complicit, often paying large amounts of money to be transported, and once in the country they wish to enter will be left to their own devices, (Source: IATE, entry for smuggler) 3. Facilitator is the broader concept, as they provide services beyond the unauthorized entry of a migrant into a country. For more information see the entry for facilitator in this glossary. O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 547
smuggling of migrants BG контрабанда на мигранти CS převaděčství migrantů DE Schleusung von Migranten EL παράνομη διακίνηση μεταναστών EN smuggling of migrants ES tráfico de inmigrantes Definition(s) The procurement, in order to obtain, directly or indirectly, a financial or other material benefit, of the irregular entry of a person into a (UN) Member State of which the person is not a national or a permanent resident. Source(s) FI maahanmuuttajien salakuljetus Art. 3 of UN Protocol against the Smuggling of Migrants by Land, Sea and Air, supplementing the UN Convention against Transnational Organised Crime FR trafic de migrants Synonym(s) ET sisserändajate ebaseaduslik üle piiri toimetamine GA smuigleáil imirceach migrant smuggling HR krijumčarenje migranata Related term(s) HU migránscsempészés IT traffico di migranti LT neteisėtas migrantų gabenimas LV migrantu kontrabanda MT Kuntrabandu ta’ migranti NL mensensmokkel PL przemyt migrantów PT auxílio à imigração ilegal RO contabandă cu migranţi SK prevádzačstvo migrantov SL tihotapljanje migrantov facilitator smuggler EMN Asylum and Migration Classification 13.1 Migrant smuggling Euro Voc Classification 2811 migration Note(s) 1.The UN Protocol against the Smuggling of Migrants by Land, Sea and Air, supple-menting the UN Convention against Transnational Organised Crime was adopted by the UN on 15 November 2020. 2. It was adopted by the European Union with Council Decision 2006/616/ EC, Art. 3 of the annex defines smuggling of migrants. SV smuggling av migranter NO smugling av migranter (b); smugling av migrantar (n) KA (სახელმწიფო) საზღვარზე მიგრანტთა უკანონოდ გადაყვანა UK незаконне ввезення мігрантів HY 548 միգրանտների մաքսանենգ ճանապարհով տեղափոխում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B social cohesion BG социално сближаване CS sociální koheze DE sozialer Zusammenhalt EL κοινωνική συνοχή EN social cohesion ES cohesión social ET sotsiaalne sidusus FI sosiaalinen yhteenkuuluvuus FR cohésion sociale GA comhtháthú sóisialta C Capacity of a society or community based on a common vision and a sense of belonging where peoples’ diverse backgrounds (including migratory) and circumstances are mutually appreciated and positively valued. E Source(s) G Related term(s) H EMN Asylum and Migration Classification I Derived by EMN from IOM Glossary on Migration, 2019. integration HR socijalna kohezija 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) HU társadalmi kohézió Euro Voc Classification IT coesione sociale D Definition(s) J 28 Social Questions K Note(s) L LT socialinė sanglauda LV sociālā kohēzija MT NL sociale cohesie PL spójność społeczna PT Coesão social RO coeziune socială SK sociálna súdržnosť / sociálna kohézia SL socialna kohezija SV social sammanhållning NO sosialt samhold(b); sosialt samhald(n) KA სოციალური შეკავშირებულობა UK соціальна згуртованість HY սոցիալական համախմբվածություն F 1. There is no universally accepted definition of social cohesion, existing definitions refer to a sense of belonging to a community with solidarity and tolerance among its members. Social cohesion aims to provide similar life opportunities and to foster inclusive relationships with mutual recognition among and within different groups. 2. Social cohesion is often used in relation to the impact of immigration on societies, but it is seldom defined in this context. In addition, terminology related to integration, social inclusion and social cohesion varies. Social cohesion is understood as the more neutral and universal term to be used in the global context, for more information see: IOM: Integration and social cohesion: key elements for reaping the benefits of migration. 3. Objective 16 of the Global Compact on Migration aims to increase the empowerment of migrants and societies to realize full inclusion and social cohesion. This include policies empowering migrants to become active members of society and promoting the reciprocal engagement of receiving communities and migrants in the exercise of their rights and obligations towards each other, including observance of national laws and respect for customs of the country of destination. It also encompasses policies which aim to strengthen the welfare of all members of societies by minimizing disparities, avoiding polarization and increasing public confidence in policies and institutions related to migration, in line with the acknowledgment that fully integrated migrants are better positioned to contribute to prosperity. For more information see: Global compact for safe, orderly and regular migration, intergovernmentally negotiated and agreed outcome, 13 July 2018. 4. Social cohesion encompasses the capacity of a society to integrate migrants without discrimination. The principle of equal treatment and non-discrimination and the notion that diversity should be considered as an asset have repercussions on migrants’ individual and collective sense of inclusion, and thus are starting points for integration. For more information see: Council of Europe: A new strategy for Social Cohesion, Chapter III : Migration and social cohesion, 2004. M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 549
social dumping BG социален дъмпинг CS sociální dumping DE Sozialdumping EL κοινωνικό ντάμπινγκ EN social dumping ES dumping social ET sotsiaalne dumping FI sosiaalinen polkumyynti FR dumping social Definition(s) The practice whereby workers are given pay and / or working and living conditions which are sub-standard compared to those specified by law or collective agreements in the relevant labour market, or otherwise prevalent there. Source(s) Derived by EMN from the Norwegian Regulations regarding workers from the new EU Member States GA dumpáil shóisialta (níor aistríodh an coincheap i dteangacha eile), coinníolacha oibre faoi bhun an chaighdeáin Narrower term(s) HR socijalni damping 14.2 Economic factors and impacts (such as brain drain/ gain, employment/ unemployment, labour market, economic growth, dumping) HU szociális dömping IT dumping sociale LT socialinis dempingas LV sociālais dempings MT Tiżbita soċjali / Dumping soċjali NL sociale dumping PL dumping socjalny PT dumping social wage dumping EMN Asylum and Migration Classification Euro Voc Classification 4416 organisation of work and working conditions Note(s) 1. There is no clear, universally accepted definition of social dumping. 2. In the EU context, this practice usually refers to EU/EFTA and third-country nationals. RO dumping social SK sociálny damping / sociálny dumping SL socialni damping SV social dumpning NO sosial dumping KA სოციალური დემპინგი UK соціальний демпінг HY 550 սոցիալական դեմպինգ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B social exclusion BG социално изключване CS sociální vyloučení DE soziale Ausgrenzung EL κοινωνικός αποκλεισμός EN social exclusion ES exclusión social ET sotsiaalne tõrjutus FI sosiaalinen syrjäytyminen FR exclusion sociale GA eisiamh sóisialta HR socijalna isključenost C D Definition(s) E In the EU context, a situation whereby a person is prevented (or excluded) from contributing to and benefiting from economic and social progress. F Source(s) Developed by EMN from the website of the European Commission, DG Employment, Social Affairs and Inclusion G H Related term(s) social inclusion I EMN Asylum and Migration Classification HU társadalmi kirekesztés 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) J IT esclusione sociale Euro Voc Classification K LT socialinė atskirtis 1236 rights and freedoms| 2826 social affairs L LV sociālā atstumtība MT Esklużjoni soċjali M NL sociale uitsluiting PL wykluczenie społeczne N PT exclusão social RO excludere socială O SK sociálne vylúčenie / sociálna exklúzia SL socialna izključenost P SV social utestängning / socialt utanförskap NO sosial eksklusjon / sosial ekskludering Q KA სოციალური გამორიცხვა/გარიყულობა R UK соціальне виключення HY սոցիալական բացառում S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 551
social inclusion BG социално включване CS sociální začlenění DE soziale Eingliederung EL κοινωνική ένταξη EN social inclusion ES inclusión social Definition(s) In the EU context, a framework for national strategy development, as well as for policy coordination between the EU Member States, on issues relating to tackling poverty and social exclusion. Source(s) FI sosiaalinen osallisuus Developed by EMN from the website of the European Commission, DG Employment, Social Affairs and Inclusion FR inclusion sociale Related term(s) ET sotsiaalne kaasatus GA cuimsiú sóisialta social exclusion HR socijalna uključenost EMN Asylum and Migration Classification LT socialinė įtrauktis 1. Framework Concepts on Migration (including root causes of migration| 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) LV sociālā iekļaušana Euro Voc Classification HU társadalmi befogadás IT inclusione sociale MT Inklużjoni soċjali 1236 rights and freedoms| 2826 social affairs NL sociale insluiting PL włączenie społeczne PT inclusão social RO includere socială SK sociálne začlenenie / sociálna inklúzia SL socialna vključenost SV social delaktighet NO sosial inkludering KA სოციალური ჩართულობა UK соціальна інтеграція HY 552 սոցիալական ներառում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B social partners BG социални партньори CS sociální partneři DE Sozialpartner EL κοινωνικοί εταίροι EN social partners ES interlocutores sociales C D Definition(s) Bodies representing employers, workers and governments when meeting for the purpose of consultations and negotiations on labour, social and economic practices, policies and legislation. E Source(s) G F FR partenaires sociaux Derived by EMN from the Constitution of the International Labour Organisation and Articles 152 and 153 of the Treaty on the Functioning of the European Union (TFEU) GA comhpháirtithe sóisialta EMN Asylum and Migration Classification ET sotsiaalpartnerid FI työmarkkinaosapuolet HR socijalni partneri 14. Factors and Impacts of Migration HU szociális partnerek Euro Voc Classification IT parti sociali LT socialiniai partneriai LV sociālie partneri MT Imsieħba soċjali NL sociale partners I J 1231 international law| 4411 labour market K Note(s) The concept of ‘social partners’ is central to the structure and governance of the International Labour Organisation (ILO), and is implied by articles 152 and 153 in the Treaty on the Functioning of the European Union (TFEU) . PL partnerzy społeczni L M N PT parceiros sociais RO O SK sociálni partneri SL socialni partnerji P SV arbetsmarknadens parter NO sosiale parter, arbeidslivets parter / partene i arbeidslivet (b); sosiale partar / arbeidslivspartar / partane i arbeidslivet (n) Q R KA სოციალური პარტნიორები UK соціальні партнери HY H S սոցիալական գործընկերներ T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 553
social protection benefits BG обезщетения за социална закрила CS dávky sociální ochrany DE Sozialschutzleistungen EL οφέλη κοινωνικής προστασίας (EL); επιδόματα κοινωνικής προστασίας (CY) EN social protection benefits ES prestaciones de asistencia social Definition(s) Transfers, in cash or in kind, by social protection schemes to households and individuals to relieve them of the burden of one or more of the risks defined in the European Commission’s Mutual Information System on Social Protection. Source(s) FR prestations de protection sociale Derived by EMN from Art. 2 of Council Regulation (EC) No 458/2007 (ESSPROS Regulation) and European Commission’s Mutual Information System on Social Protection (MISSOC) GA sochair choimirce sóisialta Narrower term(s) ET sotsiaalse kaitse hüvitised FI sosiaaliturvaetuudet HR naknade socijalne skrbi access to healthcare HU szociális védelmi juttatások EMN Asylum and Migration Classification IT prestazione di protezione sociale LT socialinės išmokos LV sociālās drošības sistēmas pabalsti / sociālās aizsardzības pabalsti MT Benefiċċji ta’ protezzjoni soċjali NL sociale uitkeringen PL zasiłki z opieki społecznej PT prestações de proteção social RO beneficii ale protecţiei sociale SK dávky sociálnej ochrany (EU acquis); sociálna pomoc SL prejemki socialne zaščite SV sociala förmåner NO ytelser knyttet til sosial sikkerhet (b); ytingar knytte til sosial tryggleik (n) KA სოციალური დახმარება/შეღავათები 1. Framework Concepts on Migration (including root causes of migration Euro Voc Classification 1011 European Union law| 2836 social protection Note(s) The European Commission’s Mutual Information Systemon Social Protection uses the following categorisation of 11 groups or branches dedicated to specific risks: 1. healthcare; 2. sickness cash benefits; 3. maternity and paternity benefits; 4. invalidity benefits; 5. old-age pensions and benefits; 6. survivors’ benefits; 7. benefits in respect of accidents at work and occupational diseases; 8. family benefits; 9. unemployment benefits; 10. guaranteed minimum resources; 11. long-term care benefits UK переваги соціального захисту HY 554 սոցիալական պաշտպանության նպաստներ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B social security BG социлно осигуряване CS sociální zabezpečení C D Definition(s) ES seguridad social A right to which every member of society is entitled to realise through national effort and international cooperation and in accordance with the organisation and resources of each state, of the economic, social and cultural rights indispensable for their dignity and the free development of their personality. ET sotsiaalkindlustus Source(s) DE soziale Sicherheit EL κοινωνική ασφάλιση EN social security FI sosiaaliturva Art. 22 of Universal Declaration of Human Rights FR sécurité sociale Narrower term(s) HR socijalna sigurnost social inclusion social protection benefits HU társadalombiztosítás Related term(s) GA slándáil shóisialta IT sicurezza sociale LT socialinė apsauga J social exclusion K EMN Asylum and Migration Classification PL zabezpieczenie socjalne Euro Voc Classification PT segurança social RO securitate socială 1236 rights and freedoms| 2836 social protection| 7606 United Nations SK sociálne zabezpečenie SL socialna varnost L M N O P SV social trygghet NO trygd Q KA სოციალური დაცვა R UK соціальна безпека HY G I NL maatschappelijke zekerheid MT Sigurtà soċjali F H 1. Framework Concepts on Migration (including root causes of migration| 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) LV sociālais nodrošinājums E սոցիալական ապահովագրություն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 555
sponsor BG спонсор CS osoba usilující o sloučení rodiny /nositel oprávnění ke sloučení rodiny DE Zusammenführender / Sponsor EL συντηρών EN sponsor ES reagrupante ET sponsor FI perheenkokoaja Definition(s) In the global context, a person or entity which undertakes a (legal, financial or personal) engagement, promise or pledge, on behalf of another. In the EU context of family reunification, a thirdcountry national residing lawfully in a Member State and applying, or whose family members apply, for family reunification to be joined with them. Source(s) GA urraitheoir General context: developed by EMN EU context: Art. 2(c) of Council Directive 2003/86/EC (Family Reunification Directive) HR pokrovitelj Related term(s) FR regroupant HU szponzor IT sponsor / soggiornante (familiare che inoltra richiesta di ricongiungimento familiare) dependant family member EMN Asylum and Migration Classification LT globėjas 3.2 Migration for Family Reasons LV galvotājs / garantētājs Euro Voc Classification MT Garanti / Sponsor NL gezinshereniger / referent / hoofdpersoon PL sponsor PT requerente de reagrupamento familiar RO sponsor SK garant / sponzor SL sponzor SV referensperson 1011 European Union law| 2806 family| 2811 migration| 7606 United Nations Note(s) According to this concept, everyone has the right to a standard of living adequate for the health and well-being of themselves and of their families, including food, clothing, housing and medical care, and necessary social services, and the right to security in the event of unemployment, sickness, disability, widowhood, old age or other lack of livelihood in circumstances beyond their control (Art. 25 of the Universal Declaration of Human Rights). NO referanseperson / sponsor KA სპონსორი/მხარდამჭერი პირი UK спонсор HY 556 հովանավոր EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B spontaneous migration BG no translation CS spontánní migrace DE spontane Migration EL αυτόβουλη μετανάστευση EN spontaneous migration ES migración espontánea ET spontaanne ränne FI spontaani maahanmuutto FR migration spontanée GA imirce spontáineach HR spontane migracije HU spontán migráció IT migrazione spontanea LT spontaniška migracija C D Definition(s) The movement of a person or a group of persons who initiate and proceed with their migration plans without any outside assistance. Source(s) Developed by EMN F G Broader term(s) H migration Related term(s) immigration programme I Note(s) J 1. Spontaneous migration is usually caused by push-pull factors and is characterised by the lack of state assistance or any other type of international or national assistance. 2. The term is not in common use. K L LV spontāna migrācija MT Migrazzjoni spontanja M NL spontane migratie PL spontaniczna migracja N PT migração espontânea RO migraţie spontană O SK spontánna migrácia SL spontane migracije P SV spontan migration NO spontan migrasjon Q KA სპონტანური მიგრაცია R UK спонтанна міграція HY E ինքնաբուխ միգրացիա S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 557
standard of proof BG изискване за доказване CS stav věci, o němž nejsou důvodné pochybnosti DE Beweisanforderung / Beweisstandard EL πρότυπο αποδείξεως EN standard of proof ES nivel de prueba ET tõendamisstandard FI näyttökynnys FR niveau de preuve GA caighdeán cruthúnais HR standard dokazivanja HU bizonyítási küszöb IT grado di intensità della prova LT įrodymams keliami reikalavimai LV pierādījumu kopums MT LIvell Standard / Grad Standard ta’ evidenza Definition(s) In the global context, the degree or level of persuasiveness of the evidence required in a specific case. In the context of international protection, the degree or level of persuasiveness of the evidence required (as the threshold to be met) by the applicant for international protection in persuading the adjudicators as to the truth of the facts of the claim and when establishing if there is a well-founded fear of persecution. Source(s) Global context: IOM Glossary on m Migration, 2019. International protection context: derived by EMN based on EASO Practical guide: evidence assessment, 2015 and UNHCR: Note on Burden and Standard of Proof, 16 December 1998 EMN Asylum and Migration Classification NL bewijsstandaard / bewijsvoeringsnorm 1. Framework Concepts on Migration (including root causes of migration PL standard dowodu Euro Voc Classification PT nível dos elementos de prova 1231 international law RO SK miera dokazovania SL dokazni standard SV beviskrav NO beviskrav Note(s) It is the applicant’s responsibility to prove facts in support of their claim. Facts which need to the ‘proved’ are those which concern the background and personal experiences of the applicant which purportedly have given rise to fear of persecution and the resultant unwillingness to avail themselves of the protection of the country of origin. KA მტკიცების სტანდარტი UK стандарт доказування HY 558 ապացուցելիության չափանիշ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
standard operating procedures applicable in hotspots BG стандартни оперативни процедури, приложими в горещи точки A B C D Definition(s) E EL τυποποιημένες διαδικασίες λειτουργίας για τα κέντρα υποδοχής και ταυτοποίησης (ΚΥΤ-Hotspots) Operational and technical guidelines on the implementation of the Hotspot Approach in case of disproportionate migratory pressure at the external EU border of any EU Member State to support the effective and sustainable preparation and operation of hotspots and the distribution of responsibilities among different stakeholders (EU and national authorities and agencies). EN standard operating procedures applicable in hotspots Source(s) H CS standardní operační procedury aplikované v hotspotech DE Standardvorgehensweise in Hotspots / Standardverfahren für Hotspots ES Procedimientos operativos estándar aplicables en los hotspots ET esmastes vastuvõtu keskustes kohaldatavad püsitoimingud FI hotspot-toimintamenettely FR procédures opérationnelles standard applicables dans les hotspots GA HR standardni operativni postupci koji se primjenjuju na žarišne točke HU a hotspotokban alkalmazott általános működési eljárások Derived by EMN from Commission Staff Working Document: Best practices on the implementation of the hotspot approach, accompanying the document, progress report on the European Agenda on Migration, SWD(2017)372 final and Standard Operating Procedures(SOPs) applicable to Italian hotspots Standard Operating Procedures (SOPs) applicable to Greek hotspots Synonym(s) LV karstajos punktos piemērojamās standartprocedūras MT Proċeduri t’ operazzjoni(jiet) standard f’inħawi/ f’sitwazzjonijiet imwiegħra NL operationele standaardprocedures van toepassing in hotspots PL standardy procedur operacyjnych stosowane w hotspotach PT procedimentos operacionais padrão aplicáveis em pontos de crise RO SK štandardné / bežné pracovné postupy v hotspotoch SL Standardni operativni postopki, ki se uporabljajo na žariščnih točkah I J K L N 4. International Protection and other Types of Protection| 6. Migration Procedures LT migrantų antplūdžio valdymo centruose taikomos standartinės veiklos procedūros G M H-SOPs Hotspot Standard Operating Procedures (H-SOPs) EMN Asylum and Migration Classification IT procedure operative standard per i punti di crisi F Euro Voc Classification O 1011 European Union law| 2811 migration P Note(s) Q 1. The SOPs should be adopted by the host Member State as early as possible prior to the start of hotspot operations and take the form of a legal act, governmental or ministerial decision or circular, depending on the host Member State›s constitutional requirements. 2. The purpose of these best practices is to set out the key principles for ensuring that hotspots are functioning effectively and that EU Member States hosting hotspots have clear guidance on what they should do, once the hotspot approach has been activated in accordance with Article 18 of the Regulation (EU) 2016/1624 (Regulation on the European Border and Coast Guard) which contains provisions on the EU operational cooperation in hotspot areas. 3. Hotspots are in operation in Greece and Italy, but the SOPs have so far only been adopted by Italy. R S T U V SV standardiserat tillvägagångssätt som tillämpas i hotspot-områden W NO standard operasjonsprosedyrer på mottakssteder for asylsøkere etablert ved et uvanlig stort antall (b); Standard operasjonsprosedyrar på mottaksstader for asylsøkjarar etablert ved eit uvanleg stort tal (n) X KA ცხელ წერტილებში გამოყენებული Y UK стандартні операційні процедури, що застосовуються в гарячих точках Z სტანდარტული ოპერაციული პროცედურები HY ընդունելության և նույնականացման կենտրոննների ստանդարտ գործառնական ընթացակարգեր EMN ASYLUM AND MIGRATION GLOSSARY 10.0 559
stateless person BG лице без гражданство CS osoba bez státní příslušnosti Definition(s) DE Staatenloser Person who is not considered as a national by any state under the operation of its law. EL ανιθαγενής Source(s) EN stateless person ES apátrida ET kodakondsuseta isik FI kansalaisuudeton FR apatride GA duine gan stát HR osoba bez državljanstva (apatrid) HU hontalan személy IT apolide Art. 1 of UN Convention relating to the Status of Stateless Persons Related term(s) citizenship EMN Asylum and Migration Classification 1. Framework Concepts on Migration (including root causes of migration Euro Voc Classification 1231 international law| 1236 rights and freedoms| 7606 United Nations LT asmuo be pilietybės LV bezvalstnieks MT Persuna apolida / bla stat Note(s) The definition also includes a person whose nationality is not established. NL staatloze PL bezpaństwowiec PT apátrida RO apatrid SK osoba bez štátneho občianstva / osoba bez štátnej príslušnosti SL apatrid / oseba brez državljanstva SV statslös NO statsløs person (b); statslaus person (n) KA მოქალაქეობის არმქონე პირი UK особа без громадянства HY 560 քաղաքացիություն չունեցող անձ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B statutory refugee BG no translation C D Definition(s) CS statutární uprchlík E ES refugiado bajo instrumentos anteriores a la Convención de 1951 Person considered to be a refugee (according to the criteria of Art. 1A(I) of the Geneva Refugee Convention and Protocol under the provision of the international instruments preceding the Geneva Refugee Convention or a person who has been recognised as a refugee by the former International Refugee Organisation during the period of its activities. ET statuudipagulane Source(s) H DE statutärer Flüchtling EL αναγνωρισμένος πρόσφυγας EN statutory refugee Derived by EMN from the UNHCR International Thesaurus of Refugee Terminology FI sääntömääräinen pakolainen (not in general use) FR réfugié statutaire J refugee HR statutarne izbjeglice Related term(s) HU történelmi menekült G I Broader term(s) GA dídeanaí de réir reachta F K IT rifugiato titolare dello status prima della Convenzione di Ginevra del 1951 Convention refugee mandate refugee LT pabėgėlis pagal susitarimus EMN Asylum and Migration Classification L Euro Voc Classification M LV statūtbēglis MT Rifuġjat(a) statutarju(-a) NL erkende vluchteling / verdragsvluchteling PL uchodźca statutowy PT refugiado estatutário RO refugiat statutar SK štatutárny utečenec SL no translation SV konventionsflykting NO statuttflyktning 4.1.1 Refugee protection 1231 international law| 2811 migration N Note(s) 1. These instruments are: The Arrangements with regard to Russian and Armenian Refugees of 12 May 1926, the Arrangement with regard to Turkish and Assyrian Refugees of 30 June 1928, the Conventions of 28 October 1933 and 10 February 1938, the Protocol of 14 September 1939 and the Constitution of the International Refugee Organisation. 2. This type of status is normally no longer granted, although the term is still used by the United Nations High Commissioner for Refugees (UNHCR) in its activities. O P Q KA მოწმობით აღიარებული ლტოლვილი R UK біженець відповідно до Женевської конвенції 1951 року S HY ճանաչված փախստական T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 561
stock of foreigners BG брой на чуждите граждани CS počet cizinců (stav k) DE Bestand der ausländischen Wohnbevölkerung EL απόθεμα πληθυσμού αλλοδαπών EN stock of foreigners ES stock de población extranjera ET välismaalaste arv FI ulkomaalaisväestön määrä Definition(s) The number of foreign nationals in a given area on a certain date (e.g. 1 January or 31 December) of the year in question. Source(s) Developed by EMN Broader term(s) foreign population of a country FR stock de ressortissants étrangers / stock de population étrangère / stock d’étrangers Narrower term(s) GA líon eachtrannach / stoc eachtrannach Related term(s) migrant stock HR broj stranaca population stock HU külföldi népesség száma Euro Voc Classification IT stock di popolazione straniera LT užsieniečių skaičius LV ārzemnieku skaits (1. janvārī) MT Rendikont tal-barranin / Rendikont tal-Popolazzjoni Barranija NL bevolking van buitenlandse nationaliteit 2816 demography and population Note(s) 1. The term is added because of the two methods used to calculate population stock. 2. Foreign stock can include migrants plus those born in a given area to foreign parents living in given area. PL populacja cudzoziemców w danym momencie PT stock de população estrangeira / stock de estrangeiros RO stoc de străini SK stav cudzincov / počet cudzincov SL število tujcev SV antal utländska medborgare NO antall utenlandske borgere (b); tal på utanlandske borgarar (n) KA უცხოელთა ჯგუფი UK чисельність іноземців HY 562 օտարերկրացիների թվաքանակ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 563
stock of pending cases (in procedures for international protection) BG брой висящи дела LV izskatīšanā esošo lietu skaits CS množství žádostí v řízení (ve věci mezinárodní ochrany) MT Rendikont ta’ każijiet pendenti (fi proċeduri għal protezzjoni internazzjonali) DE bestehende anhängige Verfahren (bei Verfahren zur Anerkennung auf internationalen Schutz) / Bestand an anhängigen Verfahren NL voorraad van hangende zaken EL αριθμός εκκρεμουσών υποθέσεων (κατά τη διαδικασία διεθνούς προστασίας) PT número de processos pendentes (pedidos de proteção internacional) EN stock of pending cases (in procedures for international protection) ES stock de solicitudes pendientes de resolver (en procedimientos de protección internacional) ET pooleliolevate juhtumite arv (rahvusvahelise kaitse menetlustes) FI päätöstä odottavien (kansainvälistä suojelua koskevien) hakemusten määrä FR stock de dossiers en attente (dans les procédures de demande de la protection internationale) GA Líon na gcásanna ar feitheamh (i nósanna imeachta um chosaint idirnáisiúnta) HR broj slučajeva u postupku (odobrenja međunarodne zaštite) PL liczba rozpatrywanych wniosków (w procedurze udzielania ochrony miedzynarodowej) RO SK stav prebiehajúcich konaní (o medzinárodnej ochrane) / stav žiadostí v riešení (v konaniach o medzinárodnej ochrane) SL število primerov v obravnavi (v postopkih mednarodne zaščite) SV ärendebalans (gällande ansökningar om internationellt skydd) NO restanse (ved behandling av søknader om internasjonal beskyttelse) (b); restanse (ved handsaming av søknadar om internasjonalt vern (n) KA განხილვის პროცესში არსებულ საქმეთა რაოდენობა (საერთაშორისო დაცვის პროცედურების ფარგლებში) HU függőben lévő ügyek száma (nemzetközi védelemre vonatkozó eljárások során) UK кількість справ на стадії розгляду (у процедурах надання міжнародного захисту) IT stock di casi pendenti (nelle procedure di protezione internazionale) HY LT nagrinėjamų bylų skaičius (prieglobsčio procedūroje) 564 EMN ASYLUM AND MIGRATION GLOSSARY 10.0 առկախված գործերի թիվը (միջազգային պաշտպանության ընթացակարգում)
A B C D Definition(s) E The number of formally lodged applications for international protection which have not yet received a decision in each stage of the procedure for international protection (first instance and final appeal) at the end of the reference period. F G Source(s) Derived by EMN from EUAA Annual Asylum Report H Broader term(s) application for international protection I Related term(s) procedure for international protection J EMN Asylum and Migration Classification 6.2 Procedure for international protection/Refugee status determination| 6.2.3 First Instance (Administrative) determination procedure| 6.2.4 Second instance (Administrative or judicial) determination procedure / Appeals Procedure K L M Euro Voc Classification 2811 migration N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 565
Stockholm Programme BG Стокхолмска програма CS Stockholmský program DE Stockholmer Programm EL Πρόγραμμα της Στοκχόλμης EN Stockholm Programme ES Programa de Estocolmo Definition(s) A five-year political, strategic document describing the focus of cooperation in the policy areas of justice and home affairs of the EU Member States for the years 2010 to 2014. Source(s) FI Tukholman ohjelma European Commission Communication on an area of freedom, security and justice serving the citizen, COM(2009) 262 final FR Programme de Stockholm Euro Voc Classification ET Stockholmi programm GA Clár Stócólm HR Stockholmski program HU Stockholmi Program IT Programma di Stoccolma LT Stokholmo programa LV Stokholmas programma MT Programm (Il-) ta’ Stokkolma NL Programma van Stockholm PL Program Sztokholmski PT Programa de Estocolmo RO Programul de la Stockholm SK Štokholmský program SL Stockholmski program SV Stockholmsprogrammet NO Stockholm-programmet KA სტოკჰოლმის პროგრამა 10 European Union| 2811 migration Note(s) 1. The Stockholm Programme is the third programme in this area. The first programme was adopted in 1999 in Tampere. The second programme, the Hague Programme, was adopted in 2004 and expired in December 2009. 2. The Programme contains guidelines for common politics on the topics of protection of fundamental rights, privacy, minority rights and the rights of groups of people in need of special protection, as well as citizenship of the European Union. The programme also outlines plans for measures in the area of border-crossing data exchange between State authorities and surveillance of the Internet. The Programme’s work programme also attaches great importance to how the EU should work to guarantee respect for fundamental freedoms and privacy, while guaranteeing security in Europe. Chapter 5 specifically outlines the priorities in migration and asylum matters (based on the principles and objectives of the Pact on Immigration and Asylum). It underlines that solidarity is an important objective of a common immigration and asylum policy and that the EU should provide support to EU Member States most exposed to migratory pressures. 3. For more information, see the Communication on an area of freedom, security and justice serving the citizen (Stockholm Programme). COM (2009) 262 final . UK Стокгольмська програма HY 566 Ստոկհոլմի ծրագիր EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B stranded migrant BG no translation DE gestrandeter Migrant (term is not used in AT, DE, LU) EL εγκλωβισμένος μετανάστης A migrant who for reasons beyond their control has been unintentionally forced to stay in a country. E Source(s) F Broader term(s) G EMN Asylum and Migration Classification H Developed by EMN EN stranded migrant ES migrante desamparado migrant ET juhusisserändaja (no usual translation) FI maahan jäämään joutunut siirtolainen (not in general use) GA imirceach sáinnithe D Definition(s) CS cizinec, kterému brání ve vycestování překážka na jeho vůli nezávislá FR migrant bloqué C 1. Framework Concepts on Migration (including root causes of migration I Euro Voc Classification 2811 migration J Note(s) K HR no usual translation HU (egy országban) rekedt migráns IT migrante bloccato LT migrantas, atsidūręs sunkioje padėtyje LV grūtā stāvoklī nonācis migrants MT Migrant(a) imwaħħal (imwaħħla) f’post NL gestrande migrant 1. There is no legal definition of the term ‘stranded migrant’; however, the term has been used by academics and organisations such as the International Organization for Migration (IOM) since 2006. According to UNESCO, migrants may become stranded due to circumstances in the country of origin, a position of prolonged detention or practical difficulties. Stranded migrants may be individuals whose claim for refugee status has been rejected. 3. For further information, see UNESCO’s People on the Move Handbook. PL migrant przymusowy L M N O PT migrante retido RO migrant forţat să rămână pe teritoriu P SK uviaznutý migrant SL ujeti migrant SV strandsatt migrant Q NO migrant med påtvunget opphold (b); migrant med påtvinga opphald (n) R KA ქვეყანაში იძულებით ჩარჩენილი მიგრანტი S UK застряглий мігрант HY արգելափակված միգրանտ T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 567
Strategic Committee on Immigration, Frontiers and Asylum (SCIFA) BG Стратегически комитет по имиграция, граници и убежище CS Strategický výbor pro přistěhovalectví, hranice a azyl DE Strategisches Komitee für Einwanderungs-, Grenz- und Asylfragen / Strategischer Ausschuss für Einwanderungs-, Grenz- und Asylfragen / SCIFA EL Στρατηγική Επιτροπή για τη Μετανάστευση, τα Σύνορα και το Άσυλο EN Strategic Committee on Immigration, Frontiers and Asylum (SCIFA) ES Comité Estratégico de Inmigración, Fronteras y Asilo ET Strateegiline sisserände-, piiride ja varjupaigakomitee FI Maahanmuutto-, raja- ja turvapaikka-asioiden strateginen komitea FR Comité stratégique sur l’immigration, les frontières et l’asile GA an Coiste Straitéiseach um Inimirce, Teorainneacha agus Tearmann HR Strateški odbor za imigraciju, granice i azil (SCIFA) HU Bevándorlással, Határokkal és Menekültüggyel Foglalkozó Stratégiai Bizottság IT Comitato Strategico in materia di Immigrazione, Frontiere e Asilo LT Imigracijos, sienų ir prieglobsčio strateginis komitetas LV Imigrācijas, robežu un patvēruma jautājumu stratēģiskā komiteja MT Kumitat Strateġiku dwar l-Immigrazzjoni, il‑Fruntieri u l-Ażil Definition(s) A forum for the exchange of information amongst the EU Member States, consisting of senior officials in the fields of asylum, immigration and frontiers, which aims to implement a European Union strategic approach to matters related to asylum, immigration and frontiers. Source(s) Note from the President of the EU Council to SCIFA, Document 17476/10 Synonym(s) SCIFA Related term(s) High-Level Working Group (HLWG) on Asylum and Migration Euro Voc Classification 2811 migration Note(s) 1. SCIFA was set up as part of a new working structure to prepare the Council’s discussions with regard to immigration, frontiers and asylum. SCIFA focuses on in-depth discussions on issues of a more strategic nature, such as politically important issues and issues of a horizontal or cross-cutting character to deal with questions arising from Articles 62, 63 and 64 of the Treaty of the European Community (TEC) with a view to synthesising and, where necessary, solving them and to give substantive input to Coreper’s discussions. SCIFA provides its conclusions to Coreper, after which they are considered by the Justice and Home Affairs (JHA) Council. 2. SCIFA can create Working Parties (e.g. Working Party on Migration and Expulsion) to consider in detail the specific proposals tabled by the European Commission. These Working Parties report on their outcomes to SCIFA. NL Strategisch Comité immigratie, grenzen en asiel PL Strategiczny Komitet ds. Imigracji, Granic i Azylu PT Comité Estratégico Imigração, Fronteiras e Asilo RO Comitetul Strategic pentru Imigraţie, Frontiere şi Azil SK Strategický výbor pre prisťahovalectvo, hranice a azyl (SCIFA) SL Strateški odbor za priseljevanje, meje in azil SV Strategiska kommittén för invandring, gränser och asyl NO Strategikomité for innvandrings-, grense- og asylspørsmål KA იმიგრაციის, საზღვრებისა და თავშესაფრის საკითხთა სტრატეგიული კომიტეტი (SCIFA) UK Стратегічний комітет з питань імміграції, кордонів і притулку (SCIFA) HY 568 Ներգաղթի, Սահմանների և Ապաստանի Ռազմավարական Կոմիտե EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B student BG студент CS student C D Definition(s) FR étudiant In the EU migration context, a third-country national accepted by an establishment of higher education and admitted to the territory of an EU Member State to pursue as their main activity a full-time course of study leading to a higher education qualification recognised by the EU Member State, including diplomas, certificates or doctoral degrees in a higher education institution, which may cover a preparatory course prior to such education, in accordance with national law, or compulsory training. GA mac léinn Source(s) DE Student EL φοιτητής / σπουδαστης EN student ES estudiante ET (üli)õpilane FI opiskelija HR student HU diák IT studente LT studentas LV students MT Student(a) NL student PL student PT estudante Art. 3(3) of Directive (EU) 2016/801 (Recast Students Directive) F G H I J Related term(s) K researcher school pupil L EMN Asylum and Migration Classification 3.3 Migration for Study and Research M Euro Voc Classification 1011 European Union law| 2811 migration| 3206 education N RO student O SK študent SL študent P SV student NO Student Q KA სტუდენტი R UK студент HY E ուսանող S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 569
subsequent application for international protection BG последваща молба за международна закрила CS následná žádost o mezinárodní ochranu DE Folgeantrag auf internationalen Schutz EL μεταγενέστερη αίτηση διεθνούς προστασίας EN subsequent application for international protection ES solicitud posterior de protección internacional ET korduv rahvusvahelise kaitse taotlus FI myöhempi kansainvälistä suojelua koskeva hakemus FR demande ultérieure de protection internationale Definition(s) A further application for international protection made after a final decision has been taken on a previous application, including cases where the applicant has explicitly withdrawn their application and cases where the determining authority has rejected an application following its implicit withdrawal in accordance with Art. 28 (1) of Directive 2013/32/EU (Recast Asylum Procedures Directive) . Source(s) GA iarratas iardain ar chosaint idirnáisiúnta Art. 2(q) of Directive 2013/32/EU (Recast Asylum Procedures Directive) HR naknadni zahtjev za međunarodnom zaštitom Broader term(s) HU ismételt nemzetközi védelem iránti kérelem IT domanda reiterata di protezione internazionale LT paskesnis prašymas suteikti tarptautinę apsaugą (EU acquis); pakartotinis prašymas suteikti prieglobstį LV atkārtots iesniegums par starptautiskās aizsardzības statusa piešķiršanu application for international protection EMN Asylum and Migration Classification 4.1 International protection Euro Voc Classification 1011 European Union law| 2811 migration MT Applikazzjoni / Talba sussegwenti għall-protezzjoni internazzjonali NL volgend verzoek om internationale bescherming PL kolejny wniosek o ochronę międzynarodową PT pedido subsequente de proteção internacional RO cerere ulterioară SK následná žiadosť o medzinárodnú ochranu / následná žiadosť o udelenie medzinárodnej ochrany SL ponovna prošnja za mednarodno zaščito SV efterföljande ansökan om internationellt skydd NO ny søknad om internasjonal beskyttelse (b); ny søknad om internasjonalt vern (n) KA განმეორებითი განცხადება საერთაშორისო დაცვის მოთხოვნის შესახებ UK подальше звернення за міжнародним захистом HY 570 միջազգային պաշտպանության հետագա հայց EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B subsidiary protection BG субсидиарна закрила CS doplňková ochrana C D Definition(s) GA cosaint choimhdeach The protection given to a third-country national or a stateless person who does not qualify as a refugee but in respect of whom substantial grounds have been shown for believing that the person concerned, if returned to their country of origin, or in the case of a stateless person to their country of former habitual residence, would face a real risk of suffering serious harm as defined in Art. 15 of Directive 2011/95/EU (Recast Qualification Directive) , and to whom Art. 17(1) and (2) of this Directive do not apply, and is unable or, owing to such risk, unwilling to avail themselves of the protection of that country. HR supsidijarna zaštita Source(s) DE subsidiärer Schutz EL επικουρική προστασία (EL); συμπληρωματική προστασία (CY) EN subsidiary protection ES protección subsidiaria ET täiendav kaitse FI toissijainen suojelu FR protection subsidiaire HU kiegészítő védelem IT protezione sussidiaria LT papildoma apsauga LV alternatīvā aizsardzība MT Protezzjoni sussidjarja NL subsidiaire bescherming PL ochrona (uzupełniająca) Derived by EMN from Art. 2(f) of Directive 2011/95/EC (Recast Qualification Directive) Broader term(s) E F G H I J K L international protection Narrower term(s) M person eligible for subsidiary protection Related term(s) N RO protecţie subsidiară civil war refugee humanitarian protection temporary protection SK doplnková ochrana EMN Asylum and Migration Classification 4.1.2 Subsidiary protection P Euro Voc Classification Q PT proteção subsidiária SL subsidiarna zaščita SV subsidiärt skydd NO subsidiær beskyttelse (b); subsidiært vern (n) O 1011 European Union law| 2811 migration KA დამატებითი დაცვა UK додатковий захист HY օժանդակ պաշտպանություն R Note(s) This term is not used in UK (see ‘humanitarian protection’). S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 571
subsidiary protection status BG статут на субсидиарна закрила CS status doplňkové ochrany DE subsidiärer Schutzstatus EL καθεστώς επικουρικής προστασίας (EL); καθεστώς συμπληρωματικής προστασίας (CY) EN subsidiary protection status ES estatuto de protección subsidiaria ET täiendava kaitse seisund FI toissijainen suojeluasema FR statut conféré par la protection subsidiaire (EU acquis) / statut de protection subsidiaire GA stádas cosanta coimhdí HR status supsidijarne zaštite HU kiegészítő védelmi jogállás / oltalmazotti státusz IT status di protezione sussidiaria LT papildomos apsaugos statusas LV alternatīvās aizsardzības statuss Definition(s) The recognition by an EU Member State of a thirdcountry national or a stateless person as a person eligible for subsidiary protection. Source(s) Art. 2(g) of Directive 2011/95/EU (Recast Qualification Directive) Broader term(s) subsidiary protection Related term(s) beneficiary of subsidiary protection refugee status withdrawal of international protection EMN Asylum and Migration Classification 4.1.2 Subsidiary protection Euro Voc Classification 1011 European Union law| 2811 migration MT Status ta’ protezzjoni sussidjarja NL subsidiaire beschermingsstatus PL status ochrony uzupełniającej PT estatuto de proteção subsidiária RO statut de protecţie subsidiară SK status doplnkovej ochrany / štatút doplnkovej ochrany SL status subsidiarne zaščite SV status som subsidiärt skyddsbehövande NO status for subsidiær beskyttelse (b); status for subsidiært vern (n) KA დამატებითი დაცვის სტატუსი UK статус додаткового захисту HY 572 օժանդակ պաշտպանության կարգավիճակ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B suspensive effect BG суспензивен ефект C D Definition(s) CS odkladný účinek DE aufschiebende Wirkung EL ανασταλτικό αποτέλεσμα EN suspensive effect ES efecto suspensivo A consequence of an appeal, which suspends the enforceability of a challenged decision allowing the appellant to remain in a host country pending the outcome. E Source(s) G Synonym(s) H F Developed by EMN ET edasilükkav toime FI lykkäävä vaikutus GA éifeacht fionraíochta right to remain pending the examination of an application right to remain pending the decision HR suspenzivni učinak Broader term(s) J FR effet suspensif I legal remedy HU halasztó hatály IT effetto sospensivo EMN Asylum and Migration Classification LT stabdomasis poveikis 6.3 Specific aspects of migration procedures K LV atliekošs efekts Euro Voc Classification L MT Effett ta’ twaħħir / ta’ sospensjoni (minħabba smigħ ta’ appell) 1011 European Union law| 2811 migration NL schorsende werking Note(s) PL skutek zawieszający PT efeito suspensivo RO efect suspensiv SK odkladný účinok SL suspenzivni učinek /odložilni učinek SV suspensiv verkan NO utsettende virkning (b); utsetjande verknad (n) KA შემაკავებელი ეფექტი UK призупиняюча дія HY M 1. The Directive 2013/32/EU/ (Recast Asylum Procedures Directive) recognises in Art. 9 an automatic right of applicants to remain in the Member State, for the sole purpose of the procedure, until the determining authority has made a decision in accordance with the procedures at first instance, and in Art. 46(3) -in line with international refugee law and with the jurisprudence of the European Courts -an automatic right of applicants appealing against negative decisions to remain in the territory of the concerned EU Member State. 2. In some circumstances (listed in Art. 46(6) of Directive 2013/32/EU), such as decisions considering an application to be manifestly unfounded in accordance with Art. 32(2) or unfounded after examination in accordance with Art. 31(8), the suspensive effect of appeal is not automatic. However, the possibility remains to request a court or tribunal for a right to stay, pending the second instance decision (Art. 46 (3) of Directive 2013/32/EU). N O P Q R S արգելակող ազդեցություն T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 573
sustainable return BG устойчиво връщане CS udržitelný návrat Definition(s) FR retour durable In the global context, policy which deters new irregular migration of returnees by reintegration of the returnee in the country of origin or return which aims to ensure them levels of economic self-sufficiency, social stability within their communities, and psychosocial wellbeing that allow them to cope with (re)migration drivers. In the EU context, the absence of migration after return because the returnee is fully integrated socially and economically in the home community. GA Source(s) DE nachhaltige Rückkehr EL βιώσιμη επιστροφή EN sustainable return ES Retorno sostenible ET jätkusuutlik tagasipöördumine FI kestävä paluu HR održivi povratak HU fenntartható visszatérés IT rimpatrio sostenibile LT tvarus grąžinimas LV ilgtspējīga atgriešanās MT Ritorn sostenibbli NL Duurzame terugkeer PL trwały powrót PT retorno sustentável Global context: Derived by EMN from IOM: Towards an integrated approach to reintegration in the context of return, 2017. EU context: European Commission, DG Migration and HomeAffairs: Comparative study on best practices to interlink pre-departure reintegrationmeasures carried out in Member States with short- and long-term reintegrationmeasures in the countries of return: final report, 2013. Synonym(s) RO returnare durabilă sustainable reintegration successful return SK udržateľný návrat EMN Asylum and Migration Classification SL trajnostno vračanje SV hållbart återvändande NO bærekraftig retur (b); berekraftig retur (n) 12. Return and Readmission Euro Voc Classification 2811 migration KA მდგრადი დაბრუნება UK стійке повернення HY 574 կայուն վերադարձ Note(s) 1. There are many definitions and approaches to describe the concept of sustainable return migration / reintegration. A systematic analysis can be found in: IOM: Comparative Research on the Assisted Voluntary Return and Reintegration of Migrants, 2015. 2. One way of defining sustainable return is defining it in a strict sense “as the absence of re-migration’(EU Commission). Another approach takes into account the socio-economic conditions (such as the availability of employment or access to housing and basic services) faced by the returnees which makes it possible to build a life in the country of origin. A third definition focuses on a number of rights, such as to public and social services, to property and to freedom of movement. While all these approaches focus on the individual, another approach looks at return in a wider perspective and focuses on the consequences of return for the wider society (for example ‘brain gain’). For further information see: Gent, Saskia and Richard Black: Defining, Measuring and Influencing Sustainable Return, Briefing, 2005. 3. There are many different definitions at the global level and equally, policies and approaches among EU Member States vary widely. For further information see: European Commission, DG Migration and Home Affairs: Comparative study on best practices to interlink pre-departure reintegration measures carried out in Member States with short- and long-term reintegration measures in the countries of return: final report, 2013. 4. Sustainable return of migrants back to their countries of origin is an important aspect of comprehensive migration management. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B take back request BG искане за обратно приемане CS žádost o přijetí zpět DE Wiederaufnahmegesuch EL αίτημα εκ νέου ανάληψης EN take back request ES ET tagasivõtmispalve FI takaisinottopyyntö FR requête aux fins de reprise en charge GA iarraidh ar ghabháil ar ais HR zahtjev za ponovni prihvat C D Definition(s) In the context of the Dublin Regulation, the formal procedure in which an (EU) Member State carrying out the process of determining the (EU) Member State responsible becomes aware that a third-country national or stateless person has made an application for international protection in another (EU) Member State or is staying on its territory without a residence document and notifies the (EU) Member State responsible to take back that person for the purpose of completing the examination of the application for international protection. Source(s) LV atpakaļuzņemšanas pieprasījums Derived by EMN from Art. 23 of Regulation (EU) No 604/2013 (Dublin III Regulation) European Parliament: Dublin Regulation on international protection applications: European Implementation Assessment. - Brussels, 2020 MT Synonym(s) HU visszavétel iránti megkeresés IT Richiesta di ripresa in carico LT prašymas atsiimti NL terugnameverzoek Take back notification PL wniosek o wtórne przejęcie Broader term(s) PT pedido de retomada Dublin transfer RO cerere de repreluare Related term(s) SK dožiadanie o prijatie späť SL zahteva za ponovni sprejem SV framställan om återtagande NO tilbaketakelsesanmodning KA თხოვნა (თავშესაფრის მაძიებლის) უკან მიღების თაობაზე UK запит на реадмісію HY հայցի հետ վերցնելը E F G H I J K L M N O Dublin criteria take charge request transfer notification P EMN Asylum and Migration Classification Q 6.2.2 Dublin Procedure Euro Voc Classification R 1011 European Union law| 2811 migration S Note(s) 1. Take back requests relate to cases where the applicant has already lodged one asylum application in an (EU) Member State and travels on to another (EU) Member State. The latter then initiates proceedings to see which (EU) Member State is responsible for ‘taking back’ the applicant. 2. For more information see European Parliamentary Research Service (EPRS): Dublin Regulation on international protection applications: European Implementation Assessment, February 2020. T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 575
take charge request BG искане за поемане на отговорността CS žádost o převzetí DE Aufnahmegesuch; Übernahmegesuch EL αίτημα αναδοχής EN take charge request ES ET vastuvõtmispalve FI vastaanottopyyntö FR requête aux fins de prise en charge GA iarraidh ar ghabháil ar láimh HR zahtjev za prihvat HU átvétel iránti megkeresés IT Richiesta di presa in carico LT prašymas perimti savo žinion LV atbildības uzņemšanās pieprasījums MT talba biex tittieħed responsabbiltà / talba biex jittieħed inkarigu NL overnameverzoek PL wniosek o przejęcie PT pedido de tomada a cargo RO cerere de preluare SK dožiadanie o prevzatie SL zahteva za sprejem SV framställan om övertagande NO overtakelsesanmodning KA თხოვნა პირის (თავშესაფრის მაძიებლად) მიღების თაობაზე UK запит про взяття відповідальності HY 576 տեղաբաշխման հայց Definition(s) In the context of the Dublin Regulation, the formal procedure in which an (EU) Member State carrying out the process of determining the (EU) Member State responsible at any time before a first decision on the substance of an asylum claim requests another (EU) Member State to take charge of the procedure of examining the application for international protection of the person concerned according to the Dublin criteria. Source(s) Derived by EMN from Art. 21 of Regulation (EU) No 604/2013/ (Dublin III-Regulation), and European Parliamentary Research Service (EPRS): Dublin Regulation on international protection applications: European Implementation Assessment, February 2020. Broader term(s) Dublin transfer Related term(s) Dublin criteria take back request transfer notification EMN Asylum and Migration Classification 6.2.2 Dublin Procedure Euro Voc Classification 1011 European Union law| 2811 migration Note(s) Take charge requests are cases where a first application is lodged and an (EU) Member State initiates the procedure to determine which (EU) Member State is responsible. An (EU) Member State can request another (EU) Member State to take charge of an applicant, usually due to the presence of family members. For more information see European Parliamentary Research Service (EPRS): Dublin Regulation on international protection applications: European Implementation Assessment, February 2020. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B talent partnership BG партньорство в подкрепа на талантите C D Definition(s) CS partnerství zaměřená na talenty Comprehensive EU policy framework as well as funding support for cooperation with third countries to better match labour and skills needs in the EU aimed at enhancing legal migration and mobility with key partners. DE Fachkräftepartnerschaft EL εταιρικές σχέσεις προσέλκυσης ταλέντων EN talent partnership ES alianza para el talento Source(s) ET talendipartnerlus FI osaamiskumppanuus European Commission: Communication on a New Pact on Migration and Asylum, COM(2020) 609 final FR partenariat destiné à attirer les talents Synonym(s) E F G H I GA comhpháirtíocht tallainne EU talent partnership HR partnerstvo za talente Broader term(s) HU tehetségi partnerségek economic migration J IT partenariato volto ad attirare talenti EMN Asylum and Migration Classification K 2.2 EU (e.g. Common European Asylum System, Qualification Directive, European Agenda for Migration)| 3.1 Migration for Economic Purposes LT talentų partnerystė LV talantu partnerība MT Sħubija ta’ talenti Euro Voc Classification NL talentpartnerschap M 04 Politics| 10 European Union| 2811 migration PL talent partnership PT Parceria de talentos N Note(s) 1. Talent partnerships should be launched first in the EU’s Neighbourhood, the Western Balkans, and in Africa, with a view to expanding to other regions. 2. The Talent Partnerships require engagement of EU Member States, involvement of the private sector and the social partners, and ownership from partner countries RO parteneriat pentru atragerea de talente SK partnerstvo zamerané na talenty / partnerstvo v oblasti mobility talentov SL partnerstvo za privabljanje talentov SV talangpartnerskap O P Q NO talentpartnerskap (b); talentpartnarskap (n) KA პარტნიორობა სწავლისა და დასაქმებისთვის R UK партнерство із залученням талантів HY L S տաղանդների ձեռքբերման շուրջ համագործակցություն T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 577
temporary external border BG временна външна граница CS dočasná vnější hranice Definition(s) GA teorainn sheachtrach shealadach (a) The common border between an EU Member State fully implementing the Schengen acquis and a EU Member State bound to apply the Schengen acquis in full, in conformity with its Act of Accession, but for which the relevant Council Decision authorising it to fully apply that acquis has not entered into force. (b) The common border between two EU Member States bound to apply the Schengen acquis in full, in conformity with their respective Acts of Accession, but for which the relevant Council Decision authorising them to fully apply that acquis has not yet enter HR privremena vanjska granica Source(s) DE vorläufige Außengrenze EL προσωρινά εξωτερικά σύνορα EN temporary external border ES frontera temporal exterior ET ajutine välispiir FI väliaikainen ulkoraja FR frontière extérieure temporaire HU ideiglenes külső határ IT frontiera esterna temporanea LT laikinoji išorės siena LV pagaidu ārējā robeža MT Fruntiera esterna temporanja / Konfini esterni temporanji Art. 2 (2) of Council Decision 574/2007/EC (External Border Fund Decision) Euro Voc Classification 0431 politics and public safety| 1011 European Union law NL tijdelijke buitengrens PL tymczasowa granica zewnętrzna PT fronteira externa temporária RO frontieră externă temporară SK dočasná vonkajšia hranica SL začasna zunanja meja SV tillfällig yttre gräns NO midlertidig ytre grense (b); mellombels ytre grense (n) KA დროებითი გარე საზღვარი UK тимчасовий зовнішній кордон HY 578 ժամանակավոր արտաքին սահմաններ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 579
temporary international relocation initiative (TIRI) BG инициатива за временно преместване в друга държава CS dočasná mezinárodní relokační iniciativa DE vorübergehende internationale Umsiedlungsinitiative EL πρωτοβουλία προσωρινής διεθνούς μετεγκατάστασης (TIRI) EN temporary international relocation initiative (TIRI) ES iniciativa de reubicación internacional temporal ET ajutine rahvusvahelise ümberpaigutamise algatus FI aloite kansainvälisistä tilapäisistä siirroista FR initiative de relocalisation internationale temporaire GA Tionscnamh um Athshocrú Sealadach Idirnáisiúnta (TASI) HR inicijativa za privremeno međunarodno preseljenje HU Ideiglenes nemzetközi relokációs kezdeményezés Definition(s) All measures for swift assistance and protection of human right defenders (HRDs) in danger in a third country by providing preventive security measures or supporting them to relocate inside their country of origin, within their region or abroad in case of urgent threat and where appropriate, issuing emergency visas and facilitating temporary shelter in EU Member States. Source(s) Derived by EMN from the European Union Temporary Relocation Platform (EUTRP) and the Website of ProtectDefenders.eu https://icorn.org/ Synonym(s) temporary international relocation initiative TIRI IT iniziativa per la ricollocazione temporanea internazionale Broader term(s) LT laikino tarptautinio perkėlimo iniciatyva Related term(s) LV pagaidu starptautiskās pārcelšanas iniciatīva human rights relocation MT Inizzjattiva temporanja Internazzjonali għarrilokazzjoni (ITIR) EMN Asylum and Migration Classification NL tijdelijk internationaal relocatie initiatief / tijdelijk internationaal herplaatsingsinitiatief (BE) Euro Voc Classification PL międzynarodowa inicjatywa relokacji tymczasowej 5. Relocation, Resettlement and Humanitarian Admission 2811 migration PT iniciativa de recolocação internacional temporária (TIRI) RO inițiativa de relocare temporară internațională (TIRI) SK iniciatíva dočasnej medzinárodnej relokácie (TIRI) SL pobuda za začasno mednarodno premestitev SV temporary international relocation initiative (TIRI) NO temporary international relocation initiative (TIRI) KA დროებითი საერთაშორისო განსახლების ინიციატივა (TIRI) UK ініціатива про тимчасове переселення за кордон (TIRI) HY 580 ժամանակավոր միջազգային վերաբնակեցման նախաձեռնություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. Human right defenders (HRDs) are people who individually or collectively work peacefully on behalf of others to promote and defend internationally recognised human rights. The United Nations Human Rights Office of the High Commissioner offers a detailed description of who human rights defenders are and what they do as well as on the Special Rapporteur on the situation of human rights defenders, for more information see the Website of the Special Rapporteur. 2. Before relocating human rights defenders outside of their country of origin, preventive measures should be taken to ensure personal safety and protection. If relocation is inevitable, priority should be given to relocation in the defender’s own country or in their sub-region, thus allowing them to continue doing their work close to their country. 3. Temporary relocation visas are one tool to protect human rights defenders at risk and in need of relocation. 4. On initiative of the European Commission a platform has been developed with the objective to facilitate coordination and cooperation among actors involved in the temporary relocation of HRDs. These actors may be based in Europe or in countries or regions where HRDs are at risk. The coordination of the platform is currently in the hands of ProtectDefenders.eu, the European Union Human Rights Defenders mechanism. For more information on the platform see the Website of ProtectDefenders.eu. 5. The temporary international relocation initiative is different from the EU’s relocation mechanism which ensures the transfer of persons in need of protection or already having a protection status from an EU Member State to another EU Member State responsible either for granting a similar protection status or examining their application of international protection. For more information see the entry of ‹relocation› in this glossary. 6. The International Cities of Refuge Network (ICORN) is an independent organisation of cities and regions offering shelter to writers and artists at risk, advancing freedom of expression, defending democratic values and promoting international solidarity. It was formally established on June 9, 2006 in Stavanger after the dissolution of the original Cities of Asylum Network (INCA) founded in 1993 by the International Parliament of Writers (IPW). Since then more than 70 cities worldwide have joined the network and no less than 200 writers and artists have found shelter in an ICORN member city. For more information see the Website of ICORN. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 581
temporary migration BG временна миграция CS dočasná migrace DE temporäre Migration EL προσωρινή μετανάστευση EN temporary migration ES migración temporal ET ajutine sisseränne FI tilapäinen maahanmuutto FR migration temporaire GA imirce shealadach HR privremena migracija HU ideiglenes migráció / átmeneti migárció IT migrazione temporanea LT trumpalaikė migracija LV īslaicīga migrācija MT Migrazzjoni temporanja NL tijdelijke migratie PL migracja tymczasowa Definition(s) Migration for a specific motivation and / or purpose with the intention that afterwards there will be a return to the country of origin or onward movement. Source(s) Developed by EMN Broader term(s) migration Related term(s) long-term migration short-term migration EMN Asylum and Migration Classification 3.4 Migration for other Reasons Euro Voc Classification 2811 migration Note(s) With regard to the development of EU policy, this may be seen in the context of inter alia circular migration and / or seasonal workers. PT migração temporária RO migraţie temporară SK dočasná migrácia SL začasne migracije SV tillfällig migration NO midlertidig migrasjon (b); mellombels migrasjon (n) KA დროებითი მიგრაცია UK тимчасова міграція HY 582 ժամանակավոր միգրացիա EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 583
temporary protection BG временна закрила CS dočasná ochrana DE vorübergehender Schutz EL προσωρινή προστασία EN temporary protection ES protección temporal ET ajutine kaitse FI tilapäinen suojelu FR protection temporaire GA cosaint shealadach Definition(s) A procedure of exceptional character to provide, in the event of a mass influx or imminent mass influx of displaced persons from third countries who are unable to return to their country of origin, immediate and temporary protection to such persons, in particular if there is also a risk that the asylum system will be unable to process this influx without adverse effects for its efficient operation, in the interests of the persons and other persons requesting protection. Source(s) HR privremena zaštita Art. 2(a) of Council Directive 2001/55/EC (Temporary Protection Directive) HU ideiglenes védelem / átmeneti védelem Broader term(s) IT protezione temporanea protection LT laikinoji apsauga Related term(s) LV pagaidu aizsardzība MT Protezzjoni temporanja NL tijdelijke bescherming PL ochrona czasowa PT proteção temporária RO protecţie temporară SK dočasná ochrana (EU acquis); dočasné útočisko SL začasna zaščita SV tillfälligt skydd civil war refugee displacement international protection mass influx subsidiary protection EMN Asylum and Migration Classification 4.3 Temporary protection Euro Voc Classification 1011 European Union law| 2811 migration NO midlertidig beskyttelse (b); mellombels vern (n) KA დროებითი დაცვა UK тимчасовий захист HY 584 ժամանակավոր պաշտպանություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C Note(s) 1. The Temporary Protection Directive is a framework for a possible temporary protection system which is not established automatically, but only after the Council of the EU acting by a qualified majority on a proposal from the Commission, agrees that there is a mass influx of displaced persons. On 4 March 2022, the Council of the EU adopted Decision (EU) 2022/382, recognising the existence of a mass influx of displaced persons from Ukraine as a result of the military invasion by Russian forces that began on 24 February 2022. The scale of the influx fulfils the criteria of the Directive. 2. With the decision’s entry into force people having fled from Ukraine may apply for a temporary residence permit as of 4 March 2022. The Council Decision applies to the following categories of persons displaced from Ukraine on or after 24 February 2022: ƒ Ukrainian nationals residing in Ukraine before 24 February 2022; ƒ stateless persons and nationals of third countries other than Ukraine, who benefited from international protection or equivalent national protection in Ukraine before 24 February 2022; and ƒ family members of the persons referred to in the first two categories, even if they are not Ukrainian nationals. According to Art. 2(2) of the Council Decision it also applies to stateless persons and nationals of third countries other than Ukraine who can prove that they were legally residing in Ukraine before 24 February 2022 on the basis of a valid permanent residence permit issued in accordance with Ukrainian law, and who are unable to return safely and permanently to their country or region of origin. Art. 2 (3) of the Council Decision allows EU Member States to apply the Council Decision to other persons, including to stateless persons and to nationals of third countries other than Ukraine, who were residing legally in Ukraine and who are unable to return safely and permanently to their country or region of origin. 3. The Temporary Protection Directive defines the decision-making procedure needed to trigger, extend or end temporary protection. It foresees harmonised rights for the beneficiaries of temporary protection, including: ƒ a residence permit for the entire duration of the protection (which can last from one year to three years), ƒ appropriate information on temporary protection, ƒ access to employment, ƒ access to accommodation or housing, ƒ access to social welfare or means of subsistence, ƒ access to medical treatment, ƒ access to education for minors, ƒ opportunities for families to reunite in certain circumstances, and ƒ guarantees for access to the normal asylum procedure. Specific provisions have been drawn up for unaccompanied minors and for those having undergone particularly traumatic experiences (such as rape, physical or psychological violence). 4.The right to temporary protection is in addition to the right to apply for international protection. It is possible to apply for international protection under the Recast Qualification Directive (Directive 2011/95/EU) at any time. Temporary protection does not affect the rules for granting refugee status or subsidiary protection status under the Qualification Directive. These continue to apply, as do the procedural rules in the Recast Asylum Procedures Directive (Directive 2013/32/EU) and the rules on the status of applicants for international protection in the Recast Reception Conditions Directive (Directive 2013/33/EU). 5. The Directive also contains provisions for the return of displaced persons to their country of origin and for excluding individuals, who have committed serious crimes or, who pose a threat to security from the benefit of temporary protection. 6. EU Member States have transposed the Directive into their national law. More information on the procedure at national level including the competent authorities in the different Member States can be found on website of the EMN “Information for Ukrainian Nationals’and the EU Commission website „EU stands with Ukraine’and on the EU Commission Website “Information for people fleeing the war in Ukraine”. 7. The Temporary Protection Directive in principle applies to all EU Member States, however, DK opted out from the Directive. New legislation is on the way that Ukrainian displaced persons do not need to apply for asylum, but will obtain a temporary residence permit with access to school, education and work. The new law will cover Ukrainian citizens and persons with refugee status in Ukraine as well as accompanying core family and other family members supported in the same household. For more information see the Website of the Danish Immigration Service. 8. CH and NO apply a temporary protection mechanism similar to that of the EU; in CH Ukrainians fleeing the war will be eligible for a temporary “S permit’ to live and immediately work there, NO is offering a temporary collective protection which does not constitute grounds for a permanent residence permit. Both countries waive an individual assessment and thus facilitate an unbureaucratic and speedy process. 9. The UK “Ukraine Family Scheme’ allows family members of British nationals, UK settled persons and certain others to come to or stay in the UK. For more information see the Website of the UK Home Office “Immigration information for Ukrainians in the UK, British nationals and their family members”. In addition, the government has announced plans for a new sponsorship scheme “Homes for Ukraine’ for Ukrainians without any family ties to the UK. The scheme will allow sponsors, such as communities, private sponsors or local authorities, to bring those forced to flee Ukraine to the UK. There will be no limit on this scheme and those who come under this scheme will also be granted leave for an initial period of 12 months and able to work and access public services. For more information see the Website of UK Government on UK visa support for Ukrainian nationals. D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 585
third country BG трета страна CS třetí země DE Drittstaat EL τρίτη χώρα EN third country ES tercer país ET kolmas riik Definition(s) A country that is not a member of the European Union as well as a country or territory whose citizens do not enjoy the European Union right to free movement, as defined in Art. 2(5) of the Regulation (EU) 2016/399 (Schengen Borders Code). Source(s) FI kolmas maa Derived by EMN from the description of ‘free movement of citizens’ on the website of Eurofound FR pays tiers Narrower term(s) HR treća zemlja safe third country third-country national HU harmadik ország EMN Asylum and Migration Classification GA tríú tír IT paese terzo LT trečioji šalis LV trešā valsts 15.1 EU External dimension of migration and mobility Euro Voc Classification 04 Politics| 2811 migration MT Pajjiż terz NL derde land PL kraj trzeci PT país terceiro RO ţară / stat terţ SK tretia krajina SL tretja država SV tredjeland NO tredjeland KA მესამე ქვეყანა UK третя країна HY 586 երրորդ երկիր EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B third-country national BG гражданин на трета страна CS státní příslušník třetí země EL πολίτης τρίτης χώρας (EL); υπήκοος τρίτης χώρας (CY) ES nacional de tercer país ET kolmanda riigi kodanik FI kolmannen maan kansalainen FR ressortissant d’un pays tiers; ressortissant de pays tiers (LU); ressortissants de pays tiers (plural) GA náisiúnach tríú tír HR državljanin treće zemlje HU harmadik országbeli állampolgár D Definition(s) DE Drittstaatsangehöriger EN third-country national C Any person who is not a citizen of the European Union within the meaning of Art. 20(1) of TFEU and who is not a person enjoying the European Union right to free movement, as defined in Art. 2(5) of the Regulation (EU) 2016/399 (Schengen Borders Code). Source(s) Art. 3(1) of Directive 2008/115/EC (Return Directive) and Art. 2(6) of Regulation (EU) 2016/399 (Schengen Borders Code) Synonym(s) TCN E F G H I J Broader term(s) IT cittadino di un paese terzo non-EU national third country K LT trečiosios šalies pilietis Narrower term(s) LV trešās valsts valstspiederīgais third-country national found to be illegally present L MT Ċittadin(a) ta’ pajjiż terz Related term(s) M NL onderdaan van een derde land / derdelander PL obywatel kraju trzeciego PT nacional de país terceiro RO resortisant al unei ţări terţe SK štátny príslušník tretej krajiny (ŠPTK) SL državljan tretje države SV tredjelandsmedborgare NO tredjelandsborger (b); tredjelandsborgar (n) KA მესამე ქვეყნის მოქალაქე UK громадянин третьої країни HY երրորդ երկրի քաղաքացի alien union citizen N EMN Asylum and Migration Classification O 15.1 EU External dimension of migration and mobility Euro Voc Classification 1011 European Union law| 2811 migration P Note(s) Q 1. According to this definition, nationals of NO, IS, LI and CH are not considered to be third-country nationals. This is also consistent with Art. 2(6) of Regulation (EU) 2016/399 (Schengen Borders Code) . 2. The Regulation (EC) No 862/2007 (Migration Statistics Regulation) has a slightly different definition for a third-country national, which considers nationals of NO, IS, LI and CH as third-country nationals. This definition is also applied in Council Directive 2009/50/EC (Blue Card Directive), Directive 2003/86/EC (Family Reunification Directive), Directive 2003/109/EC (Long Term Residents Directive) and Directive (EU) 2016/801 (Recast Students Directive). This definition was considered to be too narrow for use by the EMN. 3. Nationals of Micro-States (Monaco, San Marino, Vatican City) are treated as third-country nationals since, although there are no border controls, there is no formal agreement for them to be ‹beneficiaries of the free movement of persons› as defined in Union acquis. This also means that they cannot be part of the Schengen Agreement. R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 587
threat to public health BG CS ohrožení veřejného zdraví Definition(s) ES amenaza para la salud pública In the EU migration context, any disease with epidemic potential as defined by the International Health Regulations of the World Health Organization and other infectious diseases or contagious parasitic diseases if they are the subject of protection provisions applying to nationals of the EU Member States. ET oht rahvatervisele Source(s) DE Gefahr für die öffentliche Gesundheit EL απειλή για τη δημόσια υγεία EN threat to public health FI kansanterveyteen kohdistuva uhka FR menace pour la santé publique GA bagairt ar shláinte phoiblí HR opasnost za javno zdravlje HU közegészségügyi veszély IT LT grėsmė visuomenės sveikatai LV sabiedrības veselības apdraudējums MT Theddida għas-saħħa pubblika NL gevaar voor de volksgezondheid PL zagrożenie zdrowia publicznego PT ameaça à saúde pública RO Art.2 (21) of Regulation (EU) 2016/399 (Schengen Borders Code) EMN Asylum and Migration Classification 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) Euro Voc Classification 2811 migration| 2841 health Note(s) The World Health Organization (WHO) mentions as health challenges e.g. outbreaks of vaccine-preventable diseases like measles and diphtheria, increasing reports of drug-resistant pathogens, growing rates of obesity and physical inactivity to the health impacts of environmental pollution and climate change and multiple humanitarian crises, for further information see: WHO: Ten threats to global health in 2019, 21 March 2019. SK ohrozenie verejného zdravia SL grožnja javnemu zdravju SV hot mot folkhälsan NO trussel mot folkehelsen(b); trussel mot folkehelsa(n) KA საზოგადოებრივ ჯანმრთელობასთან დაკავშირებული საფრთხე UK загроза здоров’ю населення HY 588 հանրային առողջությանը սպառնալիք EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B torture BG изтезания CS mučení DE Folter EL βασανιστήρια EN torture ES tortura ET piinamine FI kidutus FR torture GA céasadh HR mučenje HU kínzás IT tortura LT kankinimas C D Definition(s) Any act by which severe pain or suffering, whether physical or mental, is intentionally inflicted on a person for such purposes as obtaining from them or a third person information or a confession, punishing them for an act they or a third person has committed or is suspected of having committed, or intimidating or coercing them or a third person, or for any reason based on discrimination of any kind, when such pain or suffering is inflicted by or at the instigation of or with the consent or acquiescence of a public official or other person acting in an official capacity. In the context of the case law of the European Court of Human Rights, deliberate inhuman treatment causing very serious and cruel suffering. E Source(s) K PL tortury Global context: Art. 1 of UN Convention against Torture and Other Cruel, Inhuman or Degrading Treatment or Punishment Context of the ECHR: ECtHR: Case of Ireland v. United Kingdom, Judgment of 18 January 1978, A 25, para. 167. PT tortura Related term(s) LV spīdzināšana MT Tortura NL foltering SK mučenie serious harm vulnerable person SL mučenje EMN Asylum and Migration Classification RO tortură SV tortyr NO tortur KA წამება UK катування HY խոշտանգում G H I J L M N O P 1. Framework Concepts on Migration (including root causes of migration Q Euro Voc Classification 1236 rights and freedoms R Note(s) 1. The term does not include pain or suffering arising only from, inherent in or incidental to lawful sanctions. 2.The right to freedom from torture is enshrined in many international treaties, most notably the International Covenant on Civil and Political Rights (ICCPR) and the UN Convention against Torture (UNCAT). The acceptance that torture is forbidden under any circumstances, including war, public emergency or terrorist threat, indicates that universally it is considered as a fundamental principle of customary international law. This means that even States that have not ratified any of the international treaties explicitly prohibiting torture are banned from using it against anyone, anywhere, under any circumstances. 3. Regional conventions, such as the European Convention on Human Rights (ECHR) in Art. 3 and the Charter of Fundamental Rights of the European Union in Art. 4, also recognise torture as a prohibited act. 4. Both the UNCAT and the Geneva Refugee Convention and Protocol expressly prohibit the forced return of an asylum seeker to a country where they may be at risk of torture. 5. In the EU, Art. 21 of Directive 2013/33/EU (Recast Reception Conditions Directive) explicitly considers the situation of vulnerable asylum seekers with special needs, including victims of torture. EU Member States are obliged to identify victims of torture within the asylum procedure and to assess whether they have special reception needs, including the need to access appropriate medical and psychological treatment or care. EMN ASYLUM AND MIGRATION GLOSSARY 10.0 F 589 S T U V W X Y Z
total migration BG общ размер на миграцията CS celková migrace Definition(s) DE Wanderungsvolumen The sum of the immigrations and emigrations which yields the total volume of migration. EL συνολική μετανάστευση Source(s) EN total migration ES migración total ET rände koguarv FI kokonaismuutto FR volume migratoire GA imirce iomlán HR ukupna (bruto) migracija HU teljes migráció IT migrazione totale Towards Harmonised European Statistics on International Migration (THESIM) project Related term(s) crude rate of net migration migration flow net migration population stock Euro Voc Classification 2811 migration LT bendra migracija LV migrācijas apjoms / bruto migrācija MT Migrazzjoni totali NL totale migratie PL migracja (brutto) PT migração bruta RO migraţie totală SK celková migrácia SL skupne migracije SV bruttomigration NO samlet migrasjon (b); samla migrasjon (n) KA მიგრაციის მთლიანი მოცულობა UK загальна міграція HY 590 գումարային միգրացիա EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B trafficking in human beings BG трафик на хора CS obchodování s lidmi DE Menschenhandel EL εμπορία ανθρώπων (EL); εμπορία προσώπων (CY) EN trafficking in human beings ES trata de seres humanos ET inimkaubandus FI ihmiskauppa FR traite des êtres humains GA gáinneáil i ndaoine HR trgovanje ljudima HU emberkereskedelem IT tratta di esseri umani LT prekyba žmonėmis C D Definition(s) The recruitment, transportation, transfer, harbouring or reception of persons, including the exchange or transfer of control over those persons, by means of the threat or use of force or other forms of coercion, of abduction, of fraud, of deception, of the abuse of power or of a position of vulnerability or of the giving or receiving of payments or benefits to achieve the consent of a person having control over another person, for the purpose of exploitation. E Source(s) I Synonym(s) J Narrower term(s) K Art. 2 of Directive 2011/36/EU (Trafficking Directive) human trafficking LV cilvēku tirdzniecība detection of a victim of trafficking in human beings identification of a victim of trafficking in human beings MT Traffikar ta’ persuni Related term(s) PT tráfico de seres humanos exploitation national referral mechanism Palermo Protocol RO trafic de fiinţe umane EMN Asylum and Migration Classification NL mensenhandel PL handel ludźmi SK obchodovanie s ľuďmi SL trgovina z ljudmi SV människohandel NO menneskehandel KA ადამიანით ვაჭრობა (ტრეფიკინგი) UK торгівля людьми HY մարդկանց թրաֆիքինգ F G H L M N O 13.2 Trafficking in human beings Euro Voc Classification 1236 rights and freedoms| 2811 migration P Note(s) Q 1. A position of vulnerability means a situation in which the person concerned has no real or acceptable alternative but to submit to the abuse involved. 2. Exploitation includes, as a minimum, the exploitation of the prostitution of others or other forms of sexual exploitation, forced labour or services, including begging, slavery or practices similar to slavery, servitude, or the exploitation of criminal activities, or the removal of organs. 3. The EU anti-trafficking website provides a one-stop-shop for practitioners and the public interested in the problem of trafficking. R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 591
trainee BG стажант CS stážista DE Auszubildender EL εκπαιδευόμενος EN trainee ES persona en prácticas ET praktikant FI harjoittelija FR stagiaire GA duine faoi oiliúint HR pripravnik HU gyakornok IT tirocinante / apprendista LT stažuotojas LV stažieris MT Persuna titħarreġ / fuq taħriġ Definition(s) In the EU migration context, a worker whose presence in the territory of an EU Member State is strictly limited in duration and closely connected with increasing their skills and qualifications in their chosen profession before returning to their own countries to pursue their careers. Source(s) Council Resolution of 20 June 1994 on limitation on admission of third-country nationals to the territory of the Member States for employment Narrower term(s) remunerated trainee unremunerated trainee EMN Asylum and Migration Classification 3.1 Migration for Economic Purposes Euro Voc Classification 2811 migration| 4406 employment NL stagiair PL stażysta PT estagiário / formando RO stagiar SK stážista SL pripravnik SV praktikant NO praktikant KA სტაჟიორი UK стажер HY 592 փորձնակ (պրակտիկանտ) EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B transfer notification BG уведомление за прехвърляне CS oznámení o transferu/přemístění DE Überstellungsmitteilung EL ειδοποίηση μεταφοράς EN transfer notification ES notificación de traslado ET üleandmise teavitus FI siirtoa koskeva ennakkoilmoitus FR notification de transfert C D Definition(s) E In the context of the Dublin Regulation, the official communication by the competent authority of the requesting (EU) Member State to an applicant for international protection, informing them, in a timely manner and in a language that the applicant understands, about a decision to transfer them to the (EU) Member State responsible for examining their application. F G H Source(s) HR obavijest o transferu Derived by EMN from EASO: Guidance on the Dublin procedure: operational standards and indicators 2020, p. 39 HU átadásról szóló értesítés Broader term(s) GA fógra aistrithe IT Notifica della decisione di trasferimento Dublin transfer LT pranešimas apie perdavimą Related term(s) LV paziņojums par pārsūtīšanu MT notifika ta’ trasferiment NL kennisgeving van overdracht J K take back request take charge request L EMN Asylum and Migration Classification M Euro Voc Classification N PL powiadomienie o przekazaniu 6.2.2 Dublin Procedure PT notificação de transferência ao abrigo do Regulamento de Dublin 1011 European Union law| 2811 migration O RO notificare de transfer SK oznámenie o odovzdaní P SL obvestilo o predaji SV meddelande om överföring Q NO overføringsvarsel KA შეტყობინება გადაყვანის შესახებ R UK повідомлення про трансфер HY I S տեղափոխման ծանուցում T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 593
transfer order BG заповед за прехвърляне CS rozhodnutí o transferu /rozhodnutí o přemístění DE Überstellungsanordnung EL εντολή μεταφοράς (EL); απόφαση μεταφοράς (CY) EN transfer order ES orden de traslado ET üleandmise otsus (no usual translation) Definition(s) The formal obligation of an applicant for international protection to leave an EU Member State and, within a specified period, go to the designated EU Member State responsible for examining their application for international protection. Source(s) FI siirtomääräys Derived by EMN from Regulation (EU) No 604/2013 (Dublin III Regulation) FR obligation de transfert Broader term(s) GA ordú um aistriú Dublin transfer HR odluka o transferu Related term(s) HU átadást elrendelő határozat vagy végzés IT ordine di trasferimento Dublin Convention Dublin Regulation LT nurodymas perduoti LV lēmums par patvēruma meklētāja pārsūtīšanu MT Ordni ta’ trasferiment NL overdrachtsbevel PL decyzja o przekazaniu PT decisão de transferência RO ordin de transfer SK príkaz na presun / príkaz na transfer SL nalog za transfer SV beslut om överföring NO overføringsvedtak KA ბრძანება გადაყვანის შესახებ UK наказ про трансфер HY 594 տեղափոխման որոշում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B transit BG транзит CS tranzit C D Definition(s) ES tránsito In the context of migration, passage through a country of transit of a third-country national travelling from their country of origin to an EU Member State. In the context of a visas, passage through (a) EU Member State(s) of a third-country national travelling from one third country to another third country. ET läbisõit / transiit Source(s) DE Durchreise / Transit EL διέλευση EN transit FI kauttakulku FR transit GA idirthuras HR tranzit HU tranzit IT transito LT tranzitas LV tranzīts Context of migration: Developed by EMN Context of a visa: Derived by EMN from definition for ‘transit visa’ in Common Consular Instructions on visas (2005/C 326/01) F G H I EMN Asylum and Migration Classification J Euro Voc Classification K 6.1.2 Visa policy 2811 migration L MT Transitu M NL transit / doorreis PL tranzyt N PT trânsito RO tranzit O SK tranzit SL tranzit P SV transit NO transitt Q KA ტრანზიტი R UK транзит HY E տարանցում S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 595
travel document BG документ за пътуване CS cestovní doklad DE Reisedokument EL ταξιδιωτικό έγγραφο EN travel document ES documento de viaje ET reisidokument FI matkustusasiakirja FR document de voyage GA doiciméad taistil HR putna isprava HU úti okmány IT documento di viaggio LT kelionės dokumentas LV ceļošanas dokuments Definition(s) A document issued by a government or international treaty organisation which is acceptable proof of identity for the purpose of entering another country. Source(s) Derived by EMN from IOM Glossary on Migration, 2nd ed., 2011 Narrower term(s) visa Related term(s) fraudulent travel or identity document residence document EMN Asylum and Migration Classification 6.1 Entry Conditions and Procedures Euro Voc Classification 1231 international law| 2811 migration MT Dokument tal-ivvjaġġar NL reisdocument PL dokument podróży PT documento de viagem RO document de călătorie Note(s) 1. Passports and visas are the most widely used forms of travel documents. 2. Some States also accept certain identity cards or other documents, such as residence permits. SK cestovný doklad SL potna listina / potovalni dokument SV resehandling NO reisedokument KA სამგზავრო დოკუმენტი UK проїзний документ HY 596 ճամփորդական փաստաթուղթ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B unaccompanied minor BG непридружен непълнолетен C D Definition(s) CS nezletilý bez doprovodu FI ilman huoltajaa oleva alaikäinen A minor who arrives on the territory of an EU Member State unaccompanied by the adult responsible for them by law or by the practice of the EU Member State concerned, and for as long as they are not effectively taken into the care of such a person; or - who is left unaccompanied after they have entered the territory of the EU Member State. FR mineur non accompagné Source(s) DE unbegleiteter Minderjähriger / UMF EL ασυνόδευτος ανήλικος EN unaccompanied minor ES menor no acompañado (MENA) ET saatjata alaealine HR maloljetnik bez pratnje IT minore non accompagnato LT nelydimas nepilnametis LV nepilngadīgais bez pavadības / nepilngadīga persona bez pavadības MT Minorenni mhux akkumpanjat NL alleenstaande minderjarige vreemdeling / nietbegeleide minderjarige (BE) PL małoletni bez opieki PT menor não acompanhado RO minor neînsoţit SK maloletý bez sprievodu SL mladoletnik brez spremstva SV ensamkommande barn NO enslig mindreårig (b); einsleg mindreårig (n) KA თანმხლები პირის გარეშე მყოფი არასრულწლოვანი UK неповнолітній без супроводу HY առանց ուղեկցության անչափահաս G H J Synonym(s) HU kísérő nélküli kiskorú F I Art. 2(l) of Directive 2011/95/EU (Recast Qualification Directive) GA mionaoiseach neamhthionlactha E UAM unaccompanied and separated child UASC K L Broader term(s) separated child M Related term(s) representative vulnerable person N EMN Asylum and Migration Classification 7.2 Minors and unaccompanied minors O Euro Voc Classification P 2806 family| 2811 migration Q Note(s) 1.There are significant differences between EU Member States with respect to national definitions and recording practices, for instance with regard to the age limit to be considered and whether or not they are unaccompanied. 2. In some (EU Member) States, statistics include all those who claim they are unaccompanied minors (i.e. before an age assessment has confirmed this), whereas other (Member) States only count those recognised as such by a competent authority (i.e. following an age assessment). 3. For further information, see EMN: Policies on Reception, Return and Integration Arrangements for, and numbers of, Unaccompanied Minors -an EU comparative study, 2010. An update of this 2009 study was published in 2015 entitled ‘Policies, practices and data on unaccompanied minors in EU Member States and Norway. R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 597
unfounded application for international protection BG неоснователна молба за международна закрила CS nedůvodná žádost o mezinárodní ochranu DE unbegründeter Antrag auf internationalen Schutz EL αβάσιμη αίτηση για διεθνή προστασία EN unfounded application for international protection ES solicitud infundada de protección internacional ET põhjendamatu rahvusvahelise kaitse taotlus FI perusteeton kansainvälistä suojelua koskeva hakemus FR demande de protection internationale infondée GA iarratas gan bhunús ar chosaint idirnáisiúnta HR neosnovan zahtjev za međunarodnu zaštitu HU megalapozatlan nemzetközi védelem iránti kérelem IT domanda infondata per il riconoscimento della protezione internazionale LT nepagrįstas tarptautinės apsaugos prašymas (EU acquis); nepagrįstas prašymas suteikti prieglobstį LV nepamatots starptautiskās aizsardzības pieteikums MT Applikazzjoni / Talba bla bażi għall-protezzjoni internazzjonali NL ongegrond verzoek om internationale bescherming PL bezzasadny wniosek o udzielenie ochrony międzynarodowej Definition(s) An application for international application which the determining authority has established as unfounded because the applicant does not qualify for international protection pursuant to Directive 2011/95/EU (Recast Qualification Directive) . Source(s) Art. 32 of Directive 2013/32/EU (Recast Asylum Procedures Directive) Broader term(s) application for international protection Narrower term(s) manifestly unfounded application for international protection EMN Asylum and Migration Classification 4.1 International protection| 6.2.3 First Instance (Administrative) determination procedure Euro Voc Classification 1011 European Union law| 2811 migration Note(s) EU Member States may also consider an application to be manifestly unfounded because of the existence of circumstances listed in Art. 31(8) of Directive 2013/32/EU (Recast Asylum Procedures Directive). PT pedido de proteção internacional infundado RO cerere nefondată de protecţie intrnaţională SK neopodstatnená žiadosť o medzinárodnú ochranu / neopodstatnená žiadosť o udelenie medzinárodnej ochrany SL neutemeljena prošnja za mednarodno zaščito SV ogrundad ansökan om internationellt skydd NO grunnløs søknad om internasjonal beskyttelse (b); grunnlaus søknad om internasjonalt vern (n) KA დაუსაბუთებელი განცხადება საერთაშორისო დაცვის მოთხოვნის შესახებ UK необґрунтована заява про надання міжнародного захисту HY 598 միջազգային պաշտպանության անհիմն դիմում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B Union acquis C BG достижения на правото на Съюза D Definition(s) CS unijní acquis / právo Evropské unie E MT acquis tal-Unjoni The constantly evolving body of common rights and obligations, which is binding for all EU Member States and which comprises: - the content, objectives, principles, rights and obligations contained in the Treaties of the European Union and all laws and decisions adopted under them since the Communities were established; - the case law of the Court of Justice of the European Union (CJEU); - declarations and resolutions adopted by the European Union; - instruments under the Common Foreign and Security Policy; - instruments under Justice and Home Affairs; - international agreements concluded by the European Union and those entered into by its Member States among themselves within the sphere of the Union’s activities. NL acquis van de Unie / Unie-acquis Source(s) M DE Besitzstand der Union / EU-Acquis EL κεκτημένο της ΕΕ EN Union acquis ES acervo de la Unión ET Euroopa Liidu õigustik/ liidu acquis FI Unionin säännöstö FR acquis de l’Union GA acquis an Aontais HR acquis Unije / pravna stečevina Europske unije HU uniós vívmányok IT acquis dell’Unione LT Sąjungos acquis LV Savienības acquis Description of the Union acquis on the website of DG Migration and Home Affairs PL acquis unijne PT Acervo da União G H I J K L N Synonym(s) RO Acquis al Uniunii / Acquis-ul Uniunii F O SK acquis Únie / acquis EÚ / právo Európskej únie / právo EÚ / súbor právnych predpisov EÚ acquis EU acquis SL pravni red Unije Narrower term(s) P Euro Voc Classification Q SV unionens regelverk NO EU-rettsregler (b); EU-rettsreglar (n) KA ევროკავშირის კანონმდებლობა UK acquis Союзу HY Եվրոպական Միության օրենսդրություն asylum acquis 1011 European Union law R Note(s) The term is used in the context of asylum and migration and refers to all rights and obligations that are binding on EU Member States with regard to asylum and migration. S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 599
union citizen BG гражданин на ЕС CS občan Evropské unie Definition(s) DE Unionsbürger / EU-Bürger Any person having the citizenship of an EU Member State. EL πολίτης της Ένωσης Source(s) EN union citizen Art. 20 (1) of Treaty of the Functioning of the EU (TFEU) ES ciudadano de la Unión Synonym(s) ET liidu kodanik EU citizen FI unionin kansalainen Broader term(s) FR citoyen de l’Union européenne citizenship GA saoránach den Aontas Related term(s) HR građanin Europske unije HU uniós polgár IT cittadino dell’Unione LT Sąjungos pilietis LV Savienības pilsonis MT Ċittadin(a) tal-Unjoni NL burger van de Unie non-EU national third-country national EMN Asylum and Migration Classification 1. Framework Concepts on Migration (including root causes of migration Euro Voc Classification 1011 European Union law| 1236 rights and freedoms PL obywatel Unii PT cidadão da União Europeia RO Cetăţean al Uniunii (Europene) SK občan EÚ SL državljan Unije SV unionsmedborgare NO unionsborger (b); unionsborgar (n) KA ევროკავშირის მოქალაქე UK громадянин ЄС HY 600 Եվրոպական Միության քաղաքացի EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B union preference BG преференции на ЕС CS zásada upřednostňování pracovníků ze zemí EU DE Unionspräferenz EL Ενωσιακή προτίμηση EN union preference ES Preferencia de la Unión Europea ET liidu eelistamine FI unionin etuuskohtelu FR préférence de l’Union GA tús áite do shaoránaigh de chuid an Aontais HR prednost Unije HU uniós preferencia IT preferenza comunitaria LT bendrijos pirmumo principas LV Savienības priekšrocības princips MT Preferenza Kommunitarja NL Unie preferentie PL preferencja unijna PT preferência da União Europeia C D Definition(s) The preference given by an EU Member State to workers who are nationals of other EU Member States over workers who are nationals of third countries in regard to access to their labour market. E Source(s) G Derived by EMN from Act of Accession 2005 (Annexes VI, Art. 14 and VII, Art. 14 to Art. 20 of the Protocol concerning the conditions and arrangements for admission of the Republics of Bulgaria and Romania to the European Union) Synonym(s) H I J Community preference Narrower term(s) K labour market test Euro Voc Classification 1011 European Union law| 4406 employment L Note(s) M Before the entry into force of the Lisbon Treaty, the term ‘community preference’ was the preferred term to use. N RO preferință pentru Uniune O SK zásada uprednostňovania občanov Únie / únijná preferencia P SL prednostna obravnava državljanov Unije SV unionsföreträde Q NO fortrinn for borgere av EU/EFTA-land (b); fortrinn for borgarar av EU/EFTA-land (n) R KA ევროკავშირის პრეფერენცია UK преференції ЄС HY F S Եվրոպական Միության նախընտրություն T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 601
United Nations Convention on the Rights of the Child (UNCRC) BG Конвенцията на ООН за правата на детето CS Úmluva OSN o právech dítěte DE Übereinkommen der Vereinten Nationen über die Rechte des Kindes / Internationale Kinderrechtskonvention EL Σύμβαση των Ηνωμένων Εθνών για τα Δικαιώματα του Παιδιού EN United Nations Convention on the Rights of the Child (UNCRC) ES Convención de las Naciones Unidas sobre los Derechos del niño Definition(s) An international human rights treaty setting out the civil, political, economic, social and cultural rights of children. Source(s) Derived by EMN from the Website of the United Nations Convention on the Rights of the Child Synonym(s) Convention on the Rights of the Child CRC UNCRC ET Ühinenud Rahvaste Organi-satsiooni lapse õiguste kon-ventsioon Broader term(s) FI YK:n lapsen oikeuksien sopimus Related term(s) FR Convention des Nations Unies relative aux droits de l’enfant GA Coinbhinsiún na Náisiún Aontaithe um Chearta an Linbh HR UN-ova Konvencija o pravima djeteta (UNCRC) HU a gyermek jogairól szóló ENSZ Egyezmény IT Convenzione delle Nazioni Unite sui diritti dell’infanzia e dell’adolescenza LT Jungtinių Tautų Vaiko teisių konvencija LV Apvienoto Nāciju Organizācijas Bērnu tiesību konvencija MT Konvenzjoni (Il-) tan-Nazzjonijiet Uniti fuq id-Drittijiet tat-Tfal NL Verdrag van de Verenigde Naties inzake de rechten van het kind PL Konwencja ONZ o prawach dziecka PT Convenção das Nações Unidas sobre os Direitos da Criança RO Convenția Organizației Națiunilor Unite cu privire la drepturile copilului (CDC) SK Dohovor OSN o právach dieťaťa (UNCRC) SL Konvencija Združenih narodov o pravicah otrok child best interests of the child (BIC) fundamental rights human rights EMN Asylum and Migration Classification 7.2 Minors and unaccompanied minors Euro Voc Classification 1231 international law| 2806 family Note(s) 1. The Convention on the Rights of the Child was adopted on 20 November 1989. The first international legally binding text recognizing all the fundamental rights of the child embodies four general principles: ƒ the best interests of the child (BIC) shall be a primary consideration in all actions affecting children (Art.3). ƒ there shall be no discrimination on the grounds of race, colour, sex, language, religion, political or other opinions, national, ethnic or social origin, property, disability, birth or other status (Art.2). ƒ States Parties recognize that every child has the inherent right to life and shall ensure to the maximum extent possible the survival and development of the child (Art. 6). ƒ children shall be assured the right to express their views freely in all matters affecting them, their views being given due weight in accordance with the child’s age and level of maturity (Art. 12) 2. In addition to these four principles, the CRC provides for a number of fundamental rights which include, inter alia, the need for protection from abuse, exploitation and neglect, and the importance of the physical and intellectual development of the ch SV FN:s konvention om barnets rättigheter NO FNs barnekonvensjon KA გაეროს ბავშვის უფლებათა კონვენცია (UNCRC) UK Конвенція ООН про права дитини (UNCRC) HY 602 Միացյալ Ազգերի Կազմակերպության Երեխայի Իրավունքների Կոնվենցիա EMN ASYLUM AND MIGRATION GLOSSARY 10.0
United Nations High Commissioner for Refugees (UNHCR) BG Върховен комисар на ООН за бежанците A B C D Definition(s) CS Úřad Vysokého komisaře OSN pro uprchlíky DE Hoher Flüchtlingskommissar der Vereinten Nationen EL Ύπατης Αρμοστεία των Ηνωμένων Εθνών για τους Πρόσφυγες (ΥΑ του ΟΗΕ για τους Πρόσφυγες) EN United Nations High Commissioner for Refugees (UNHCR) The refugee agency of the United Nations (UN) mandated to lead and coordinate international action to protect refugees and resolve refugee problems worldwide, and to safeguard the rights and well-being of refugees. Source(s) ES Alto Comisionado de las Naciones Unidas para los Refugiados Website of UNHCR ET ÜRO pagulaste ülemvolinik UNHCR FI Yhdistyneiden kansakuntien pakolaisasiain päävaltuutettu Related term(s) GA Ard-Choimisinéir na Náisiún Aontaithe do Dhídeanaithe HR Visoki povjerenik Ujedinjenih naroda za izbjeglice IT Alto Commissariato delle Nazioni Unite per i Rifugiati LT Jungtinių Tautų Vyriausiasis pabėgėlių komisaras LV Apvienoto Nāciju Organizācijas Augstais komisārs bēgļu jautājumos Geneva Refugee Convention and Protocol International Organization for Migration (IOM) international protection refugee law J EMN Asylum and Migration Classification L Euro Voc Classification M K 1231 international law| 2811 migration N Note(s) MT Kummissjoni (Il-) Għolja għar-Rifuġjati tan‑Nazzjonijiet Uniti NL Hoog Commissariaat voor de vluchtelingen van de Verenigde Naties / VN-Vluchtelingenorganisatie PL Wysoki Komisarz Narodów Zjednoczonych do Spraw Uchodżców G I 4.1.1 Refugee protection HU Az ENSZ Menekültügyi Főbiztosa F H Synonym(s) FR Haut-Commissariat des Nations Unies pour les réfugiés E 1. The Office of the United Nations High Commissioner for Refugees was established on 14 December 1950 by the UN General Assembly. 2. The Geneva Refugee Convention and Protocol is the basic statute guiding the UNHCR›s work. The functions of the UNHCR are defined in the Statute of the Office of the UN High Commissioner for Refugees, which was adopted by the General Assembly on 14 December 1950. 3. For further information, see the website of the UNHCR. O P Q R PT Alto Comissariado das Nações Unidas para os Refugiados S RO Înaltul Comisariat al Naţiunilor Unite pentru Refugiaţi / Înatul Comisariat ONU pentru Refugiaţi T SK Úrad Vysokého komisára OSN pre utečencov SL Visoki komisariat Združenih narodov za begunce SV FN:s flyktingkommissariat / FN:s flyktingorgan U NO FNs høykommissær for flyktninger (b); FNs høgkommissær for flyktningar (n) V KA გაეროს ლტოლვილთა უმაღლესი კომისრის W ოფისი (UNHCR) UK Управління Верховного комісара ООН у справах біженців (УВКБ ООН) HY X Միացյալ Ազգերի Կազմակերպության Փախստականների Հարցերով Գերագույն Հանձնակատար Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 603
unremunerated trainee BG стажант без възнаграждение CS neplacený stážista DE unbezahlter Auszubildender EL μη αμειβόμενος εκπαιδευόμενος EN unremunerated trainee ES persona en prácticas no remuneradas Definition(s) A third-country national who has been admitted to the territory of an EU Member State for a training period without remuneration in accordance with its national legislation. Source(s) ET tasustamata praktikant Art. 2(d) of Directive (EU) 2016/801 (Researchers’ Directive) FI palkaton harjoittelija Broader term(s) FR stagiaire non rémunéré GA oiliúnaí nach bhfaigheann luach saothair HR pripravnik bez naknade trainee Related term(s) HU javadalmazásban nem részesülő gyakornok remunerated trainee researcher IT tirocinante non retribuito EMN Asylum and Migration Classification LT neatlygintinas stažuotojas 3.3 Migration for Study and Research LV nealgots praktikants / stažieris Euro Voc Classification MT Persuna titħarreġ bla ħlas NL onbezoldigd stagiair 1011 European Union law| 2811 migration| 3206 education PL stazysta niepobierający wynagrodzenia PT estagiário / formando não remunerado RO stagiar neremunerat SK neplatený stážista SL neplačani pripravnik SV oavlönad praktikant NO ulønnet praktikant (b); ulønt praktikant (n) KA არაანაზღაურებადი სტაჟიორი UK неоплачуваний стажер HY 604 չվճարվող փորձնակ (պրակտիկանտ) EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B usual residence C BG обичайно местоживеене D Definition(s) CS obvyklé místo pobytu ES residencia habitual The place at which a person normally spends the daily period of rest, regardless of temporary absences for purposes of recreation, holiday, visits to friends and relatives, business, medical treatment or religious pilgrimage or, in default, the place of legal or registered residence. ET alaline elukoht Source(s) DE üblicher Aufenthaltsort EL συνήθης διαμονή EN usual residence FR résidence habituelle GA gnáthchónaí HU szokásos tartózkodási hely I EMN Asylum and Migration Classification J 1. Framework Concepts on Migration (including root causes of migration IT dimora abituale LT nuolatinė gyvenamoji vieta K Euro Voc Classification LV pastāvīgā dzīvesvieta L 2811 migration MT Residenza abitwali / tas-soltu M NL gewone verblijfplaats / gewoonlijke verblijfplaats (BE) PL zwyczajowe miejsce pobytu N PT residência habitual RO reședința obișnuită O SK obvyklý pobyt SL običajno prebivališče P SV stadigvarande bosättning NO vanlig bosted (b); vanleg bustad (n) Q KA მუდმივი საცხოვრებელი ადგილი R UK звичайне місце проживання HY G Synonym(s) habitual residence HR uobičajeno boravište F H Art. 2(1)a of Regulation (EC) No 862/2007 (Migration Statistics Regulation) FI vakinainen asuinpaikka E սովորական կեցություն S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 605
usually resident population BG обичайно живеещо население CS obyvatelstvo s obvyklým pobytem DE Wohnbevölkerung EL συνήθης διαμένων πληθυσμός EN usually resident population Definition(s) The number of persons who, on a given reference date, are usually resident in a defined geographical area (e.g. national, regional or local). Source(s) FR population résidente Derived by EMN from Art. 2(d) of Regulation (EC) No 763/2008 (Population and Housing Censuses Regulation) and Art. 2(1) of Regulation (EC) No 862/2007 (Migration Statistics Regulation) GA daonra gnáthchónaitheach Broader term(s) ES población residente ET püsielanikkond FI vakinaisesti asuva väestö HR stanovništvo s uobičajenim boravištem usual residence HU szokásos tartózkodási hellyel rendelkező népesség Related term(s) IT popolazione abitualmente residente LT nuolatiniai gyventojai LV pastāvīgie iedzīvotāji MT Popolazzjoni ta’ residenti abitwali NL geregistreerde bevolking / werkelijke bevolking PL populacja rezydentów PT população residente RO populația rezidentă obișnuită SK obyvateľstvo s obvyklým pobytom SL prebivalstvo z običajnim prebivališčem SV stadigvarande bosatta NO fastboende befolkning (b); fastbuande folkesetnad (n) KA მუდმივი მოსახლეობა UK постійно проживаюче населення HY 606 սովորական մշտական բնակչություն population stock EMN Asylum and Migration Classification 1. Framework Concepts on Migration (including root causes of migration Euro Voc Classification 2811 migration| 2816 demography and population Note(s) 1. The ‘number of persons’ includes both nationals and foreigners (and can include both legally and irregularly residing). 2. In this context, ‘usually resident’ means the place where a person normally spends the daily period of rest, regardless of temporary absences for purposes of recreation, holidays, visits to friends and relatives, business, medical treatment or religious pilgrimage. 3. The following persons alone shall be considered to be usual residents of the geographical area in question: a) those who have lived in their place of usual residence for a continuous period of at least 12 months before the reference date; or b) those who arrived in their place of usual residence during the 12 months before the reference date with the intention of staying there for at least one year. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B verification of identity BG проверка на самоличността C D Definition(s) CS ověření totožnosti DE Identitätsüberprüfung / Identitätsbestätigung / Überprüfung der Identität / Verifizierung der Identität The process of comparing sets of data to establish the validity of a claimed identity of a person (one-to-one check). EL επαλήθευση ταυτότητας Source(s) FI henkilöllisyyden todentaminen Art. 3 (1)13) of Regulation (EU) 2017/2226 (Entry/Exit System (EES)-Regulation) and Art. 4 (5) of Regulation 2019/817 (Regulation on interoperability between EU information systems in the field of borders and visa) FR vérification de l’identité Broader term(s) EN verification of identity ES verificación de la identidad ET isikusamasuse kontrollimine GA fíorú aitheantais HR provjera idnetiteta/verifikacija identiteta HU személyazonosság ellenőrzése IT verifica dell’identità LT tapatybės nustatymas LV identitātes pārbaude MT Verifika tal-identità NL verificatie van de identiteit PL weryfikacja tożsamości PT verificação da identidade RO SK overenie totožnosti; overovanie totožnosti establishment of identity F G H I J Related term(s) identification K EMN Asylum and Migration Classification 6.3.2. Establishment of identity of applicants for international protection (incl. examination of documents, language analysis, age assessment) Euro Voc Classification 2811 migration L M N Note(s) O For further information see: EMN Inform on processing biometric data, 2023. P SL preverjanje identitete SV verifiering av identitet Q NO verifisering av identitet KA ვინაობის დადასტურება R UK підтвердження особи HY E S ինքնության հաստատում T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 607
victimisation BG виктимизация CS viktimizace DE Viktimisierung EL θυματοποίηση EN victimisation ES victimización ET ohvristamine FI uhriutuminen FR victimisation GA íospairt Definition(s) Adverse treatment or adverse consequence as a reaction to a complaint or to proceedings aimed at enforcing compliance with the principle of equal treatment. Source(s) Art. 9 of Council Directive 2000/43/EC (Racial Equality Directive) Related term(s) principle of equal treatment EMN Asylum and Migration Classification HR viktimizacija 1. Framework Concepts on Migration (including root causes of migration HU viktimizáció Euro Voc Classification IT vittimizzazione 1011 European Union law| 1236 rights and freedoms LT persekiojimas LV viktimizācija MT Vittimizzazzjoni NL represailles / victimisatie (in judicial practice) PL wiktymizacja PT vitimização RO victimizare SK viktimizácia SL viktimizacija SV repressalier NO represalier (b); represaliar (n) KA მსხვერპლად ქცევა (ვიქტიმიზაცია) UK віктимізація HY 608 զոհի վիճակում հայտնվել EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B visa BG виза CS vízum C ET viisa In the global context, the authorisation or decision of a State required for admission, transit through, entry of aliens for an intended stay or exit from the State. In the Schengen context, the authorisation or decision of a Schengen State required for transit or entry for an intended stay in that Schengen State or in several Schengen States. FI viisumi Source(s) DE Visum EL θεώρηση εισόδου EN visa ES visado D Definition(s) E F G H IT visto Global context: Derived by EMN from Art. 2(m) of Regulation (EU) No 604/2013 (Dublin III Regulation) and IOM Glossary on Migration, 2019. Schengen context: Derived by EMN from Art. 2(m) of Regulation (EU) No 604/2013 (Dublin III Regulation) LT viza Broader term(s) FR visa GA víosa HR viza HU vízum LV vīza travel document MT Viża Narrower term(s) NL visum PL wiza PT visto RO viză SK vízum SL vizum SV visering K L M EMN Asylum and Migration Classification P NO visum KA ვიზა Euro Voc Classification HY J airport transit visa long-stay visa short-stay visa Visa Code visa facilitation agreement Visa Information System (VIS) 6.1 Entry Conditions and Procedures| 6.1.1 Border control| 6.1.2 Visa policy| 6.1.3 Schengen governance UK віза I N O Q 1011 European Union law R Note(s) S մուտք արտոնագիր (վիզա) 1. The European Union has established with the Visa Code a common visa policy. The Visa Code defines in Art. 2(2) a short-stay visa as the usual form of visa, without explicitly designating it as such. It allows for transit through or intended stays in the territory of a Schengen State of no more than 90 days in any 180 days period and for transit through the international transit areas of airports of the Schengen States. Visas for visits exceeding that period re-main subject to national procedures. 2. The Schengen visa is the most common visa for Europe, it is a short-stay visa allowing a person to travel to any Member State of the Schengen Area, per stay up to 90 days, inter alia, for tourism or business purposes.It enables its holder to enter, freely travel within, and leave the Schengen zone from any of the Schengen member countries. There are no border controls within the Schengen Zone. 3. Citizens from some non-EU countries are required to hold a visa when travelling to the Schengen Area. The EU has a common list of countries whose citizens must have a visa when crossing the external EU borders and a list of countries whose citizens are exempt from that requirement. These lists are set out in Regulation (EU) 2018/1806. 4. For more information see the Visa Policy Webpage of DG Migration and Home Affairs. EMN ASYLUM AND MIGRATION GLOSSARY 10.0 609 T U V W X Y Z
Visa Code BG Визов кодекс CS vízový kodex DE Visakodex EL Κώδικας Θεωρήσεων EN Visa Code ES Código de visados ET viisaeeskiri FI viisumisäännöstö FR code des visas GA an cód le haghaidh Víosaí HR Zakonik o vizama HU Vízumkódex Definition(s) Regulation outlining the procedures and conditions for issuing visas for transit through or intended stays in the territory of the Schengen Member States not exceeding three months in any six-month period. Source(s) Art. 1(1) of Regulation (EC) No 810/2009 (Visa Code) Synonym(s) Schengen Visa Code Broader term(s) visa Related term(s) IT Codice dei visti visa facilitation agreement Visa Information System (VIS) LT Vizų kodeksas EMN Asylum and Migration Classification LV Vīzu kodekss MT Kodiċi dwar il-viżi 6.1 Entry Conditions and Procedures| 6.1.1 Border control| 6.1.2 Visa policy| 6.1.3 Schengen governance NL Visumcode Euro Voc Classification PL kodeks wizowy PT Código de Vistos RO Codul de vize SK vízový kódex 1011 European Union law Note(s) The Visa Code Regulation entered into force on 5 April 2010. SL Vizumski zakonik SV viseringskodex NO visumregelverk KA სავიზო კოდექსი UK Візовий кодекс HY 610 Վիզայի Կանոնագիրք EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B visa facilitation agreement BG Споразумение за облекчаване на визовия режим CS dohoda o usnadnění vydávání krátkodobých víz / facilitační dohoda DE Visaerleichterungs-Abkommen EL συμφωνία για την απλούστευση / διευκόλυνση της έκδοσης θεωρήσεων EN visa facilitation agreement ES acuerdo de facilitación de visados ET viisalihtsustusleping C D Definition(s) Agreement between the EU and a non-EU country that facilitates the issuance by an EU Member State of authorisations to the citizens of that non-EU country for transiting through or an intended stay in the territory of the EU Member States of a duration of no more than 90 days in any 180-day period from the date of first entry into the territory of the EU Member States. E Source(s) H FI viisumihelpotussopimus Derived by EMN from the definition of Visa in Art. 2(2) of Regulation (EC) No 810/2009 (Visa Code) FR accord visant à faciliter la délivrance de visas Broader term(s) GA comhaontú um éisiúint víosaí a éascú visa HR sporazum o viznim olakšicama Related term(s) F G I J K IT accordo di facilitazione del visto Visa Code Visa Information System (VIS) LT susitarimas dėl vizų režimo supaprastinimo EMN Asylum and Migration Classification L MT Ftehim għall-iffaċilitar fil-ħruġ ta’ viżi / biex jitħaffef il-ħruġ ta’ viżi Euro Voc Classification M NL visumfacilitatieovereenkomst / visumversoepelingsovereenkomst Note(s) HU vízumkönnyítési megállapodás 6.1.1 Border control| 6.1.2 Visa policy LV nolīgums par vīzu atvieglotu izsniegšanu PL umowa o ułatwieniach wizowych PT acordo sobre a facilitação da emissão de vistos RO acord pentru facilitarea acordării vizelor SK dohoda o zjednodušení postupu pri vydávaní víz SL sporazum o vizumskih olajšavah SV viseringsförenklingsavtal NO visumfasiliteringsavtale KA შეთანხმება სავიზო რეჟიმის გამარტივების N 1. The agreements introduce simplified procedures to make issuing shortstay visas (no more than 90 days per period of 180 days) an easier process for the non-EU countries and citizens concerned. 2. With the aim of facilitating further European integration, cooperation and people-to-people contacts, the EU launched ‘visa liberalization dialogues’ with the Western Balkans and EaP countries. As a result of fulfilling requirements set by the respective roadmaps and action plans, assessed by EC’s consecutive progress reports, the citizens of five Western Balkans and three EaP countries were given the right to enter and stay in EU/Schengen states without a visa for the period of 90 days within 180-day period. For more information see the European Commission Webpage on Visa Liberalisation. 3. For the complete list of visa facilitation agreements concluded so far, see the Visa Policy Website of DG Migration and Home Affairs, შესახებ P Q R S T UK угода про спрощення візового режиму HY O մուտքի արտոնագրերի դյուրացման մասին համաձայնագիր U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 611
Visa Information System (VIS) BG Визова информационна система CS Vízový informační systém DE Visa-Informationssystem EL Σύστημα Πληροφοριών για τις Θεωρήσεις EN Visa Information System (VIS) ES Sistema de Información de Visados ET viisainfosüsteem FI viisumitietojärjestelmä FR Système d’information sur les visas GA an Córas Faisnéise Víosaí; VIS Definition(s) A system for the exchange of visa data between EU Member States, which enables authorised national authorities to enter and update visa data and to consult this data electronically. Source(s) Art. 1 of Council Decision 2004/512/EC Synonym(s) VIS Related term(s) HU Vízuminformációs rendszer Schengen Information System (SIS) Visa Code visa facilitation agreement IT Sistema di Informazione Visti EMN Asylum and Migration Classification HR vizni informacijski sustav (VIS) LT Vizų informacinė sistema LV Vīzu informācijas sistēma 6.1 Entry Conditions and Procedures| 6.1.1 Border control| 6.1.2 Visa policy MT Sistema ta’ Informazzjoni dwar il-Viża Euro Voc Classification NL Visuminformatiesysteem PL System Informacji Wizowej PT Sistema de Informação de Vistos RO Sistemul Informatic de Vize 1011 European Union law Note(s) The Visa Information System (VIS) started operating in North Africa on 11 October 2011 (see: European Commission Press release IP/11/1169) . SK Vízový informačný systém (VIS) SL Vizumski informacijski sistem SV informationssystemet för viseringar NO visuminformasjonssystemet KA ვიზის საინფორმაციო სისტემა (VIS) UK Візова інформаційна система (VIS) HY 612 Վիզաների Տեղեկատվական Համակարգ EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B voluntary departure BG доброволно напускане CS dobrovolné vycestování C D Definition(s) DE freiwillige Ausreise Compliance with the obligation to return within the time-limit fixed for that purpose in the return decision. E EL εθελούσια αναχώρηση Source(s) EN voluntary departure Art. 3(8) of 2008/115/EC (Return Directive) F ES salida voluntaria Broader term(s) G ET vabatahtlik lahkumine forced return FI vapaaehtoinen maasta poistuminen Narrower term(s) H FR départ volontaire assisted voluntary return GA imeacht deonach Related term(s) I HR dragovoljni odlazak HU önkéntes távozás IT partenza volontaria LT savanoriškas išvykimas LV brīvprātīga izceļošana MT Tluq volontarju NL vrijwillig vertrek PL dobrowolny wyjazd PT abandono voluntário RO plecare voluntară SK dobrovoľný odchod return decision voluntary return J EMN Asylum and Migration Classification K Euro Voc Classification L 12.1 Voluntary return 1011 European Union law| 2811 migration M Note(s) 1.The term is different from voluntary return, as with voluntary departure, ultimately there will be an obligation to return. 2. As voluntary departure is the preferred option over forced return, Art. 7(1) of Directive 2008/115/EC (ReturnDirective) defines an obligation for EU Member States to provide for an appropriate period for voluntary departure of between seven and thirty days. SL prostovoljni odhod O P SV frivillig avresa NO frivillig utreise (b); friviljug utreise (n) Q KA ნებაყოფლობითი გამგზავრება R UK добровільний від’їзд HY N կամավոր մեկնում S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 613
voluntary return BG доброволно връщане CS dobrovolný návrat DE freiwillige Rückkehr EL εθελούσια επιστροφή EN voluntary return ES retorno voluntario ET vabatahtlik tagasipöördumine FI vapaaehtoinen paluu FR retour volontaire GA filleadh deonach HR dragovoljni povratak HU önkéntes visszatérés IT ritorno volontario / rimpatrio volontario LT savanoriškas grįžimas LV brīvprātīga atgriešanās MT Ritorn volontarju NL vrijwillige terugkeer PL dobrowolny powrót PT retorno voluntário RO returnare voluntară SK dobrovoľný návrat SL prostovoljna vrnitev / prostovoljno vračanje SV frivilligt återvändande NO frivillig retur (b); friviljug retur (n) / assistert retur KA ნებაყოფლობითი დაბრუნება UK добровільне повернення HY 614 կամավոր վերադարձ Definition(s) The assisted or independent return to the country of origin, transit or third country, based on the free will of the returnee. Source(s) IOM Glossary on Migration, 2019. Synonym(s) voluntary repatriation Broader term(s) return Narrower term(s) assisted voluntary return Related term(s) forced return voluntary departure EMN Asylum and Migration Classification 12.1 Voluntary return Euro Voc Classification 1011 European Union law| 2811 migration Note(s) 1. The term is different from voluntary departure where there is ultimately an obligation to return. 2. The types of persons returning without the assistance of the State include those who: a) would be under no (legal) obligation to do so. As stated in the definition, it is entirely their decision as to whether they return or not; b) are irregularly resident and have not (yet) been apprehended/detected (e.g. overstayer), but who decide to return anyway; c) have applied to stay (e.g. asylum seeker, person applying for international protection) and whose application has not yet been finalised, but decide to return anyway. 3. The United Nations High Commissioner for Refugees (UNHCR) prefers the term ‹voluntary repatriation›. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B vulnerable person BG уязвимо лице CS zranitelná osoba DE schutzbedürftige Person EL ευάλωτο άτομο EN vulnerable person ES persona vulnerable ET haavatav isik FI haavoittuvassa asemassa oleva henkilö FR personne vulnérable C D Definition(s) Minors, unaccompanied minors, disabled people, elderly people, pregnant women, single parents with minor children, victims of trafficking in human beings, persons with serious illnesses, persons with mental disorders and persons who have been subjected to torture, rape or other serious forms of psychological, physical or sexual violence, such as victims of female genital mutilation. Source(s) E F G H GA duine soghonta Art. 21 of Directive 2013/33/EU (Recast Reception Conditions Directive) I HR ranjiva osoba Narrower term(s) J Related term(s) K HU sérülékeny személy IT persona vulnerabile LT pažeidžiamas asmuo applicant with special reception needs MT Persuna vulnerabbli identified victim of trafficking in human beings presumed victim of trafficking in human beings torture unaccompanied minor NL kwetsbare persoon EMN Asylum and Migration Classification LV mazāk aizsargāta persona (EU acquis); īpaši aizsargājama persona L M 4. International Protection and other Types of Protection| 7. Vulnerable Groups N PT pessoa vulnerável RO persoană vulnerabilă Euro Voc Classification O PL osoba wymagająca szczególnego traktowania SK zraniteľná osoba SL ranljiva oseba SV utsatt person NO sårbar person KA მოწყვლადი პირი UK вразлива особа HY 1011 European Union law| 2811 migration P Note(s) 1. Directive 2011/36/EU (Anti-trafficking Directive) defines a ‘position of vulnerability’ as a “situation in which the person concerned has no real or acceptable alternative but to submit to the abuse involved”. 2. Some directives use narrower definitions such as Directive 2008/115/ EG (Return Directive) in its Art. 3(9). Q R S խոցելի անձ T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 615
war crime BG военно престъпление CS válečný zločin DE Kriegsverbrechen EL έγκλημα πολέμου EN war crime ES crímenes de guerra ET sõjakuritegu Definition(s) Grave breaches of the Geneva Conventions or other serious violations of the laws and customs applicable in international armed conflicts within the established framework of international law, as defined in the Rome Statute of the International Criminal Court. Source(s) FI sotarikokset Art. 8(2) of the Rome Statute of the International Criminal Court FR crime de guerre Related term(s) HR ratni zločin crime against humanity exclusion clause HU háborús bűncselekmény Euro Voc Classification GA coir chogaidh IT crimine di guerra 1231 international law| 7606 United Nations LT karo nusikaltimas LV kara noziegums MT Reati tal-gwerra NL oorlogsmisdaad / oorlogsmisdrijf PL zbrodnie wojenne PT crime de guerra RO crime de război SK vojnový zločin SL vojni zločin SV krigsförbrytelse NO krigsforbrytelse (b); krigsbrotsverk (n) KA ომის დანაშაული UK воєнний злочин HY 616 պատերազմական հանցագործություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B well-founded fear of persecution BG добре обоснован страх от преследване CS odůvodněný strach z pronásledování The fear of persecution experienced by an applicant for international protection that is considered both genuine and objectively justifiable (e.g. because the person concerned has already been subject to persecution or serious harm, or to direct threats of such persecution or such harm, and there is no good reason to consider that such persecution or serious harm will not be repeated). EL βάσιμος φόβος δίωξης EN well-founded fear of persecution ES temor justificado de persecución ET põhjendatud tagakiusamise kartus FI perusteltu vainon pelko FR crainte fondée de persécution Source(s) GA faitíos roimh ghéarleanúint a bhfuil bunús / údar maith leis Broader term(s) Derived by EMN from IOM Glossary on Migration, 2019. Related term(s) HU üldöztetéstől való megalapozott félelem LT visiškai pagrįsta baimė būti persekiojamam LV pamatotas bailes no vajāšanas NL gegronde vrees voor vervolging PT receio fundado de perseguição SK opodstatnená obava z prenasledovania SL utemeljen strah pred preganjanjem SV välgrundad fruktan för förföljelse NO velbegrunnet frykt for forfølgelse (b); velgrunna frykt for forfølging (n) HY հետապնդման հիմնավորված երկյուղ I Euro Voc Classification M N Note(s) RO teamă de persecuţie bine fondată H L 1231 international law| 2811 migration PL uzasadniona obawa przed prześladowaniem G EMN Asylum and Migration Classification 4.1.1 Refugee protection MT Biża’ ġustifikata ta’ persekuzzjoni F K credibility assessment real risk of suffering serious harm IT giustificato timore di persecuzione E J persecution HR osnovan strah od proganjanja UK обґрунтовані побоювання переслідування D Definition(s) DE begründete Furcht vor Verfolgung KA დევნის საფუძვლიანი შიში C 1. This is a key element of the definition of a refugee in the Geneva Refugee Convention and Protocol. Well-foundedness of fear contains both a subjective element (fear of persecution) and an objective element (the fear must have an objectively justifiable basis). Both elements must be established for the fear to be considered well-founded within the meaning of the refugee definition. According to the 1951 Convention, persecution must be linked to any one of the five specified grounds: race, religion, nationality, membership of a particular social group and political opinion. 2. The subjective element is satisfied if the applicant’s fear of persecution is genuine. In the context of refugee status determination, fear has been defined as an apprehension or awareness of danger. General dissent or disagreement with a government or the desire for more personal freedom or an improved economic situation without anything more does not satify this element (see UNHCR guidelines on international protection on the UNHCR website). 3. The objective element is satisfied when the applicant has established that there is a reasonable possibility that they will actually suffer the feared persecution. O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 617
withdrawal of an application for international protection BG оттегляне на молба за международна закрила CS zpětvzetí žádosti o mezinárodní ochranu DE Rücknahme des Antrags auf internationalen Schutz EL ανάκλησης της αίτησης για διεθνή προστασία EN withdrawal of an application for international protection ES retirada de una solicitud de protección internacional Definition(s) The actions by which the applicant terminates the procedures initiated by the submission of their application for international protection, in accordance with Directive 2013/32/EU (Recast Asylum Procedures Directive), either explicitly or tacitly. Source(s) ET rahvusvahelise kaitse taotluse tagasivõtmine Derived by EMN from Art. 27 and 28 of Directive 2013/32/EU (Recast Asylum Procedures Directive) FI kansainvälistä suojelua koskevan hakemuksen peruuttaminen Broader term(s) FR retrait d’une demande de protection internationale GA iarratas ar chosaint idirnáisiúnta a tharraingt siar application for international protection EMN Asylum and Migration Classification HR odustajanje od zahtjeva za međunarodnu zaštitu 4.1 International protection| 6.2 Procedure for international protection/Refugee status determination HU nemzetközi védelem iránti kérelem visszavonása Euro Voc Classification IT ritiro della domanda di protezione internazionale 1011 European Union law| 2811 migration LT tarptautinės apsaugos prašymo atsiėmimas (EU acquis); prašymo suteikti prieglobstį nagrinėjimo nutraukimas LV starptautiskās aizsardzības pieteikuma atsaukšana MT Irtirar ta’ applikazzjoni għall-protezzjoni internazzjonali NL intrekking van een verzoek om internationale bescherming PL wycofanie wniosku o ochronę międzynarodową PT retirada do pedido de proteção internacional RO retragerea cerere de protectie internationala SK späťvzatie žiadosti o medzinárodnú ochranu / späťvzatie žiadosti o udelenie medzinárodnej ochrany SL umik prošnje za mednarodno zaščito SV återkallande av ansökan om internationellt skydd NO tilbaketrekking av søknad om internasjonal beskyttelse (b); tilbaketrekking av søknad om internasjonalt vern (n) KA საერთაშორისო დაცვის მოთხოვნის შესახებ განცხადების გამოხმობა UK відклик заяви про надання міжнародного захисту HY 618 միջազգային պաշտպանության դիմումի կասեցում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
withdrawal of international protection BG отнемане на международна закрила CS odnětí mezinárodní ochrany DE Aberkennung des internationalen Schutzes EL ανάκληση διεθνούς προστασίας EN withdrawal of international protection ES retirada de la protección internacional D E Source(s) G FI kansainvälisen suojelun poistaminen Narrower term(s) HR oduzimanje međunarodne zaštite C The decision by a competent authority to revoke, end or refuse to renew the refugee or subsidiary protection status of a person in accordance with Directive 2011/95/EU (Recast Qualification Directive) . ET rahvusvahelise kaitse äravõtmine FR retrait d’une protection internationale B Definition(s) Art. 2(o) of Directive 2013/32/EU (Recast Asylum Procedures Directive) GA cosaint idirnáisiúnta a tharraingt siar A F H withdrawal of refugee status I Related term(s) HU nemzetközi védelem visszavonása refugee status subsidiary protection status J IT revoca della protezione internazionale EMN Asylum and Migration Classification K LT tarptautinės apsaugos panaikinimas (EU acquis); prieglobsčio panaikinimas 4.1 International protection| 6.2 Procedure for international protection/Refugee status determination LV starptautiskās aizsardzības statusa atņemšana Euro Voc Classification MT Irtirar tal-protezzjoni internazzjonali 1011 European Union law| 2811 migration M NL intrekking van de internationale bescherming N PL cofnięcie ochrony międzynarodowej PT retirada do estatuto de proteção internacional O RO retragerea protecţiei internaţionale SK odňatie medzinárodnej ochrany P SL odvzem mednarodne zaščite SV återkallande av internationellt skydd Q NO tilbaketrekking av internasjonal beskyttelse (b); tilbaketrekking av internasjonalt vern (n) R KA საერთაშორისო დაცვის გამოხმობა UK позбавлення міжнародного захисту HY L S միջազգային պաշտպանության կասեցում T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 619
withdrawal of refugee status BG отнемане на бежански статут CS odnětí postavení uprchlíka DE Aberkennung der Flüchtlingseigenschaft EL ανάκληση καθεστώτος πρόσφυγα EN withdrawal of refugee status ES retirada del estatuto de refugiado Definition(s) The decision by a competent authority to revoke, end or refuse to renew the refugee status of a person in accordance with Directive 2011/95/EU (Recast Qualification Directive) . Source(s) ET pagulasseisundi kehtetuks tunnistamine Derived by EMN from Art. 2(o) of Directive 2013/32/EU (Recast Asylum Procedures Directive) FI pakolaisaseman poistaminen Broader term(s) FR retrait du statut de réfugié GA stádas dídeanaí a tharraingt siar HR oduzimanje statusa izbjeglice HU menekült státusz visszavonása IT revoca dello status di rifugiato withdrawal of international protection Related term(s) refugee status EMN Asylum and Migration Classification LT pabėgėlio statuso panaikinimas 4.1.1 Refugee protection| 6.2 Procedure for international protection/Refugee status determination LV bēgļa statusa zaudēšana Euro Voc Classification MT Revoka / Kanċellazzjoni / Tneħħija tal-istatus ta’ refuġjat 1011 European Union law| 2811 migration NL intrekking van de vluchtelingenstatus PL cofnięcie statusu uchodźcy PT retirada do estatuto de refugiado RO retragerea statutului de refugiat SK odňatie postavenia utečenca (EU acquis) SL odvzem statusa begunca SV återkallande av flyktingstatus NO tilbakekall av flyktningstatus (b); attendekalling av flyktningstatus (n) KA ლტოლვილის სტატუსის გამოხმობა UK позбавлення статусу біженця HY 620 փախստականի կարգավիճակի կասեցում EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D E F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 621
work permit BG Разрешение за работа CS povolení k zaměstnání DE Arbeitserlaubnis EL άδεια διαμονής για εργασία EN work permit ES Autorización de trabajo ET tööluba FI työlupa FR autorisation de travail / permis de travail GA Cead oibre HR radna dozvola HU munkavállalási engedély IT permesso di soggiorno per motivi di lavoro LT leidimas dirbti LV darba atļauja MT Permess tax-xogħol NL werkvergunning; arbeidskaart / toelating tot arbeid / arbeidsvergunning (BE) PL zezwolenie na pracę PT autorização de trabalho RO permis de muncă Definition(s) In the global context, a legal document issued by a competent authority of a State giving authorisation for employment of migrant workers in the host country during the period of validity of the permit. In the EU context, a legal document issued by a competent authority of an EU Member State stating the right of a third-country national to work in its territory during the period of validity of the permit. Source(s) Global context: IOM Glossary on Migration, 2019. EU-context: Derived by EMN from IOM Glossary on Migration, 2019. Broader term(s) employment Narrower term(s) EU Blue Card Related term(s) residence permit single application procedure single permit EMN Asylum and Migration Classification SK pracovné povolenie 3.1 Migration for Economic Purposes| 8.2 Access to employment SL delovno dovoljenje / dovoljenje za delo Euro Voc Classification SV arbetstillstånd 2811 migration| 4426 labour law and relations NO Arbeidstillatelse (b); Arbeidsløyve (n) KA შრომის ნებართვა UK дозвіл на працевлаштування HY 622 աշխատանքի թույլտվություն EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A B C D Note(s) E 1. The right of third-country nationals to work in an EU/EFTA Member State mainly depends on the laws of that EU/EFTA Member State. EU Member States differ as to whether they issue a residence permit in addition to a work permit, and/or whether they issue a joint residence/ work permit. All EU Member States have provisions in place outlining certain migrants who may be exempt from the obligation to obtain a work permit or for whom facilitated admission procedures are in place. 2. At EU level, different legislative instruments regulate the admission and residence of third-country nationals for the purposes of employment, depending on different categories of migrant workers and their residence status (such as highly-qualified migrants, seasonal workers, au pair, students, intra-corporate transferees, posted workers, longterm residents). For further information, see European Migration Network (EMN): Satisfying Labour Demand through Migration, 2011, 3. Directive 2011/98/EU (Single Permit Directive) introduced a single application procedure for the issuing of single permits for non-EU nationals to reside and work in the territory of an EU Member State, and a common set of rights for non-EU workers legally residing in an EU Member State notably the right to equal treatment with nationals of the country where they reside and work for housing and employment advice services. The Directive applies to most non-EU nationals with authorisation to reside and work in the EU, independently of their initial reason for admission, unless they are explicitly excluded from the scope of the Directive. Its scope includes both non-EU nationals seeking to be admitted to an EU Member State in order to stay and work there and those who are already resident and have access to the labour market or are already working there. 4. Art.15 of Directive 2013/33/EU (Recast Reception Conditions Directive) gives applicants for international protection the right of having access to the labour market no later than 9 months from the date when the application was lodged, in accordance with the conditions as set up by the national law of EU Member States. In addition, Art. 26 of Directive 2011/95/EU (Recast Qualification Directive) stipulates that EU Member States shall authorise beneficiaries of international protection to engage in employed or self-employed activities, immediately after protection has been granted. F G H I J K L M N O P Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 623
xenophobia BG ксенофобия CS xenofobie DE Ausländerfeindlichkeit / Fremdenfeindlichkeit / Xenophobie EL ξενοφοβία EN xenophobia ES xenofobia ET ksenofoobia / võõraviha FI muukalaispelko FR xénophobie GA seineafóibe HR ksenofobija HU xenofóbia / idegengyűlölet IT xenofobia LT ksenofobija Definition(s) Attitudes, prejudices and behaviour that reject, exclude and often vilify persons, based on the perception that they are outsiders or foreigners to the community, society or national identity. Source(s) Declaration on Racism, Discrimination, Xenophobia and Related Intolerance against Migrants and Trafficked Persons, adopted by the Asia-Pacific NGO Meeting for the World Conference Against Racism, Racial Discrimination, Xenophobia and Related Intolerance, Teheran, 18 February 2001 Related term(s) racial discrimination racism EMN Asylum and Migration Classification LV ksenofobija 14.3 Social factors and impacts (such as changes in demographics, age, education level, diversity) MT Ksenofobija Euro Voc Classification NL xenofobie PL ksenofobia PT xenofobia RO xenofobie SK xenofóbia SL ksenofobija SV främlingsfientlighet NO fremmedfrykt (b); framandfrykt (n) KA ქსენოფობია UK ксенофобія HY 624 այլատյացություն 1236 rights and freedoms| 2826 social affairs Note(s) 1. According to Union acquis, and specifically Art. 1 of Framework Decision 2008/913/JHA, offences concerning racism and xenophobia are considered to be: (a) publicly inciting to violence or hatred directed against a group of persons or a member of such a group defined by reference to race, colour, religion, descent or national or ethnic origin; (b) the commission of an act referred to in point (a) by public dissemination or distribution of tracts, pictures or other material; (c) publicly condoning, denying or grossly trivialising crimes of genocide, crimes against humanity and war crimes as defined in Articles 6, 7 and 8 of the Statute of the International Criminal Court, directed against a group of persons or a member of such a group defined by reference to race, colour, religion, descent or national or ethnic origin when the conduct is carried out in a manner likely to incite violence or hatred against such a group or a member of such a group; d) publicly condoning, denying or grossly trivialising the crimes defined in Art. 6 of the Charter of the International Military Tribunal appended to the London Agreement of 8 August 1945, directed against a group of persons or a member of such a group defined by reference to race, colour, religion, descent or national or ethnic origin when the conduct is carried out in a manner likely to incite violence or hatred against such a group or a member of such a group. EMN ASYLUM AND MIGRATION GLOSSARY 10.0
A Zaragoza Declaration on Integration BG Декларация от Сарагоса по въпросите на интеграцията A declaration of the European Ministerial Conference on Integration to further develop the core idea of integration as a driver for development and social cohesion by incorporating integration issues in a comprehensive way in all relevant policy fields with a focus on three areas: employment and education, comprehensive participation and evaluation of integration policies DE Zaragoza-Erklärung zum Thema Integration / Zaragosa-Erklärung zur Integration EL Διακήρυξη (της Ευρωπαϊκής Υπουργικής Διάσκεψης) της Σαραγόσα για την Ένταξη EN Zaragoza Declaration on Integration ES Source(s) ET Zaragoza deklaratsioon integratsiooni teemal C D Definition(s) CS Deklarace o integraci ze Zaragozy B E F G H FI Zaragozan julistus kotouttamisesta Derived by EMN from the Declaration on the European Website on Integration I FR Déclaration de Saragosse sur l’intégration Synonym(s) GA Zaragosa Declaration J HR Zaragoza deklaracija o integraciji Broader term(s) integration K HU Zaragozai Nyilatkozat az integrációról IT Dichiarazione di Saragozza sull’integrazione Related term(s) L Common Basic Principles integration indicators National Contact Points on Integration LT Saragosos deklaracija integracijos klausimais LV Saragosas deklarācija par integrāciju MT NL Verklaring van Zaragoza over integratie PT Declaração de Zaragoça SK Deklarácia zo Zaragozy k integrácii Euro Voc Classification O P Note(s) SL Zaragoška izjava o vključevanju SV Zaragozadeklarationen om integration NO Zaragoza-erklæringen om integrering KA სარაგოსის დეკლარაცია ინტეგრაციის შესახებ Սարագոսայի հռչակագիր ինտեգրման մասին N 2811 migration RO Declarația de la Zaragoza privind integrarea HY EMN Asylum and Migration Classification 9. Integration PL Deklaracja z Saragossy w sprawie integracji UK Сарагоська декларація про інтеграцію M 1. The Declaration was agreed at the European Ministerial Conference on Integration in Zaragoza of 15 and 16 April 2010. Council Conclusions incorporating the Declaration were adopted at the Justice and Home Affairs Council of 3-4 June 2010: 2. Employment and education are key parts in the integration process. Further development of the concept of ‘human capital’ should ensure a cross-sectoral approach, including programmes for education, employment and lifelong learning. 3. Comprehensive participation requires appropriate cooperation and coordination between different levels of government and public administration (European, national, regional and local). National Contact Points on Integration play an important role in promoting the integration of immigrants at both European Union and EU Member State level. 4. With regard to the evaluation of integration policies the declaration includes suggestions to further develop integration indicators based on qualitative or subjective data, they should complement the existing indicators in the four policy areas: employment, education, social inclusion and active citizenship. Q R S T U V W X Y Z EMN ASYLUM AND MIGRATION GLOSSARY 10.0 625
English index absconding accelerated international protection procedure access to education access to employment access to healthcare access to procedures for recognition of qualifications access to social welfare access to the procedure for international protection accommodation centre accompanied child acculturation acquisition of citizenship act of persecution Action Plan on the integration of third-country nationals active citizenship actor of persecution or serious harm actor of protection adaptation admissibility interview admissibility of an application for international protection admission onto the territory adoption (of a child) adoption (of legal acts) adoption of convenience adult advance passenger information (API) Africa Caribbean Pacific (ACP) Observatory on Migration Africa-EU Migration, Mobility and Employment Partnership age assessment airport transit visa alien alternative to detention applicant for international protection applicant in need of special procedural guarantees applicant with special reception needs application for asylum application for international protection apprehension arranged marriage Asia-Europe Meeting (ASEM) assigned area of residence assimilation 626 14 15 16 18 20 21 22 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 46 47 48 49 50 51 52 53 54 55 56 57 58 59 assisted voluntary return assisted voluntary return and reintegration programme (AVRR) asylum Asylum and Migration Management Regulation asylum seeker asylum shopping Asylum, Migration and Integration Fund (AMIF) au pair Automated Border Control (ABC) Automated Fingerprint Identification System (AFIS) awareness raising campaign on the risk of irregular migration Bali Process beneficiary of international protection beneficiary of subsidiary protection benefit of the doubt best interests of the child (BIC) biometric data Black Sea Synergy border area border control border crossing border crossing point border resident brain circulation brain drain brain gain brain waste breeder documents Budapest Process burden of proof carrier carriers’ liability case worker in procedures for international protection Centre for Information, Discussion and Exchange on the Crossing of Frontiers and Immigration (CIREFI) chain migration change of status Charter of Fundamental Rights of the European Union child child labour child’s best interests assessment (BIA) child’s best interests determination (BID) EMN ASYLUM AND MIGRATION GLOSSARY 10.0 60 61 62 63 64 65 66 67 68 69 70 72 73 74 75 76 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 96 98 99 100 101 102 103 104
circular migration citizenship civic orientation course civil partnership of convenience civil war refugee Common Basic Principles Common European Asylum System (CEAS) Common Security and Defence Policy (CSDP) community sponsorship complementary pathway for admission to third countries content of international protection contract migrant worker Convention grounds for persecution Convention refugee Cooperation Platform on Migration and Development Cotonou Agreement country of birth country of destination country of nationality country of origin country of origin information (COI) country of return country of transit Court of Justice of the European Union (CJEU) credibility assessment crime against humanity cross-border worker crude rate of net migration cultural diversity cultural mediator cultural pluralism culture de facto population de facto refugee de jure population degrading treatment or punishment dependant detainee detection of a victim of trafficking in human beings detention detention facility detention standards and conditions determining authority Dialogue on Mediterranean Transit Migration 105 106 107 108 109 110 111 112 113 114 diaspora direct discrimination displaced person displacement distribution key dual citizenship Dublin Convention Dublin criteria Dublin procedure Dublin Regulation Dublin transfer durable solutions Eastern Partnership (EAP) economic migrant economic migration emergency response system emigrant emigration employee employer employer sanction employment enforcement measure entry ban Entry/Exit System (EES) environmental migrant environmentally displaced person equality of arms establishment of identity ethnic cleansing ethnic nationality EU Action Plan on Return EU Blue Card EU Blue Card holder EU Immigration Portal EU skills profile tool for third-country nationals EU Talent Pool EU-LAC Structured Dialogue on Migration Eurasil Eurodac Euro-Mediterranean Partnership (EUROMED) European Agenda on Migration European Asylum Support Office (EASO) European Border and Coast Guard European Border and Coast Guard Agency (Frontex) 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 180 182 183 184 186 187 188 189 190 191 192 194 195 196 197 198 199 200 201 202 EMN ASYLUM AND MIGRATION GLOSSARY 10.0 627 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 146 148 150 152 153
European Border and Coast Guard Standing Corps European Border Surveillance System (EUROSUR) European Convention on Human Rights (ECHR) European Court of Human Rights (ECtHR) European Guardianship Network (EGN) European integrated border management European Integration Network (EIN) European Migration Forum (EMF) European migration liaison officer (EMLO) European Migration Network (EMN) European Neighbourhood Policy (ENP) European return liaison officer (EURLO) European travel document for return European Travel Information and Authorisation System (ETIAS) European Union Agency for Asylum (EUAA) European Union Agency for Criminal Justice Cooperation (Eurojust) European Union Agency for Fundamental Rights (FRA) European Union Agency for Law Enforcement Cooperation (Europol) European Union Emergency Trust Fund for Africa (EUTF for Africa) Eurostat evidence assessment examination of an application for international protection exclusion clause ex-nunc examination exodus exploitation expulsion expulsion decision external dimension of EU migration and asylum policy external EU border facilitator False and Authentic Documents Online (FADO) false declaration of parenthood family formation family member family migration family reunification family tracing female genital mutilation final decision 628 204 205 206 207 208 209 210 211 212 214 216 217 218 219 220 222 224 226 228 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 246 248 249 250 251 252 final decision rejecting an application for international protection first country of asylum first instance decision Five plus Five (5+5) Dialogue on Migration in the Western Mediterranean forced labour forced marriage forced migrant forced migration forced return forced return monitoring foreign population of a country fraudulent travel or identity document frontier worker fundamental rights gender gender identity gender-based persecution gender-specific violence General Directors’ Immigration Services Conference (GDISC) Geneva Refugee Convention and Protocol genocide Global Approach to Migration and Mobility (GAMM) Global Forum on Migration and Development (GFMD) group determination of refugee status group persecution guardian guest worker harassment harmful onward movement High-Level Network for Return High-Level Working Group (HLWG) on Asylum and Migration highly qualified employment highly qualified migrant host country host entity host Member State host society hotspot approach hotspot area human rights human rights law EMN ASYLUM AND MIGRATION GLOSSARY 10.0 254 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 278 279 280 282 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298
humanitarian admission humanitarian protection humanitarian visa identification identification mission identification of a victim of trafficking in human beings identified victim of trafficking in human beings identity document illegal employment illegal employment of a legally staying third-country national illegal employment of an illegally staying thirdcountry national immigrant immigration Immigration Liaison Officer (ILO) immigration programme immigration quota impostor inadmissible application for international protection indirect discrimination indiscriminate violence informal economy Information and Coordination Network for Member States’ Migration Management Services (ICONet) inhuman treatment or punishment integration integration indicators integration programme intercultural dialogue Intergovernmental Consultations on Migration, Asylum and Refugees (IGC) internal EU border internal protection internally displaced person International Civil Aviation Organisation (ICAO) format International Organization for Migration (IOM) international protection interpreter intra-corporate transferee intra-EU mobility irregular entry irregular migrant irregular migration 299 300 302 304 305 306 307 308 309 310 312 314 315 316 317 318 319 320 321 322 323 324 326 327 328 329 330 332 334 335 336 337 338 339 340 341 342 344 346 348 Irregular Migration Management Application (IRMA) irregular stay ius sanguinis ius soli Joint Valletta Action Plan (JVAP) Khartoum Process labour market integration labour market test labour matching labour migration labour shortage language analysis for the determination of origin (LADO) language training legal entry legal migration legal pathway LGBTIQ Lisbon Treaty local border traffic lodging an application for international protection long-stay visa long-term migrant long-term migration long-term mobility long-term resident loss of citizenship making an application for international protection managed migration mandate refugee manifestly unfounded application for international protection marriage of convenience mass influx material reception conditions migrant Migrant Integration Policy Index (MIPEX) migrant stock migrant worker migration migration crisis migration flow migration management support team Migration Preparedness and Crisis Blueprint migration profile EMN ASYLUM AND MIGRATION GLOSSARY 10.0 349 350 351 352 353 354 356 358 359 360 361 362 363 364 365 366 368 369 370 371 372 373 374 375 376 377 378 379 380 382 384 385 386 388 390 391 392 394 396 398 399 400 402 629
migration route migration routes initiative Migration, Asylum, Refugees Regional Initiative (MARRI) migratory pressure minimum standards minor minority mixed migration flow mobility partnership multiculturalism mutual information mechanism mutual recognition agreement National Contact Points on Integration national referral mechanism naturalisation net migration New Pact on Migration and Asylum New York Declaration for Refugees and Migrants non-EU national non-refoulement non-removable returnee nuclear family obligation to cooperate obligation to report occupation organised crime organised criminal group overstayer Palermo Protocol particular social group partnership of convenience persecution person eligible for subsidiary protection person enjoying temporary protection person with a migratory background personal interview for international protection population stock positive discrimination posted worker postponement of removal Prague Process preparatory class presumed victim of trafficking in human beings prima facie refugee 630 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 434 435 436 437 438 439 440 441 442 443 444 445 446 447 principle of equal treatment procedural guarantees procedure for international protection protection Public Register of Authentic Travel and Identity Documents Online (PRADO) pull factor push back push factor push-pull factor quota Rabat Process racial discrimination racism Rapid Border Intervention Team (RABIT) readmission readmission agreement real risk of suffering serious harm receiving Member State reception reception centre reception conditions reception facilities recognition of foreign qualifications recognition rate (in procedures for international protection) re-entry reflection period refugee refugee in orbit refugee in transit refugee law refugee status refugee sur place refusal of entry regional development and protection programme (RDPP) regularisation regulated profession reintegration reintegration assistance rejected applicant for international protection relocation remain in the Member State remittance removal EMN ASYLUM AND MIGRATION GLOSSARY 10.0 448 449 450 451 452 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 490 492 493 494
removal order remunerated trainee repatriation repatriation assistance representative researcher resettled refugee resettlement resettlement programme residence document residence permit return Return Coordinator return counselling return decision return intervention return operation returnee right of asylum right of residence right to an effective remedy right to asylum right to family life right to family unity right to free movement risk of absconding safe country of origin safe third country Schengen Agreement Schengen Borders Code Schengen Convention Schengen evaluation and monitoring mechanism Schengen Information System (SIS) school pupil search and rescue (SAR) operation seasonal worker secondary movement of migrants second-generation migrant segregation self-employed person separated child serious harm sex sexual orientation short-stay visa 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 short-term migrant short-term migration short-term mobility single application procedure single permit Sirene Bureau Smart Borders Package smuggler smuggling of migrants social cohesion social dumping social exclusion social inclusion social partners social protection benefits social security sponsor spontaneous migration standard of proof standard operating procedures applicable in hotspots stateless person statutory refugee stock of foreigners stock of pending cases (in procedures for international protection) Stockholm Programme stranded migrant Strategic Committee on Immigration, Frontiers and Asylum (SCIFA) student subsequent application for international protection subsidiary protection subsidiary protection status suspensive effect sustainable return take back request take charge request talent partnership temporary external border temporary international relocation initiative (TIRI) temporary migration temporary protection third country third-country national threat to public health 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 EMN ASYLUM AND MIGRATION GLOSSARY 10.0 631 560 561 562 564 566 567 568 569 570 571 572 573 574 575 576 577 578 580 582 584 586 587 588
torture total migration trafficking in human beings trainee transfer notification transfer order transit travel document unaccompanied minor unfounded application for international protection Union acquis union citizen union preference United Nations Convention on the Rights of the Child (UNCRC) United Nations High Commissioner for Refugees (UNHCR) unremunerated trainee usual residence 632 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 usually resident population verification of identity victimisation visa Visa Code visa facilitation agreement Visa Information System (VIS) voluntary departure voluntary return vulnerable person war crime well-founded fear of persecution withdrawal of an application for international protection withdrawal of international protection withdrawal of refugee status work permit xenophobia Zaragoza Declaration on Integration EMN ASYLUM AND MIGRATION GLOSSARY 10.0 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 622 624 625
EMN ASYLUM AND MIGRATION GLOSSARY 10.0 633
List of synonyms 5+5 Dialogue 1951 Convention Relating to the Status of Refugees and the 1967 Protocol Relating to the Status of Refugees 1951 Geneva Convention 1951 Refugee Convention ABC accelerated procedure for international protection access to the labour market accompanied minor ACP ACP Observatory on Migration acquis advance passenger data Advance Passenger Information System affirmative action AFIS Africa-EU MME Partnership AMIF amnesty (in the context of migration) API APIS ASEM asylum application asylum case worker asylum claim asylum determination officer asylum interview asylum procedure asylum recognition rate automated border control system Automated Fingerprint Identification System AVR assisted voluntary return and reintegration AVR assisted voluntary return and reintegration package AVVR awareness raising and information campaign on migration Bali Process on People Smuggling, Trafficking in Persons and Related Transnational Crime Barcelona Process beneficiary of temporary protection best interest of the child best interests of the child assessment best interests of the child determination BIA 634 258 274 274 274 68 15 18 26 43 43 599 42 42 441 69 45 66 484 42 42 57 53 95 53 95 439 450 473 68 69 61 61 61 71 72 198 437 76 103 104 103 BIC biometrics black market business migrant case officer case worker CEAS child’s best interests assessment child’s best interests determination circumcision CIREFI Civic-cultural training Civic orientation course civic training (civil) war refugee CJEU clandestine employment clandestine migrant clandestine migration COI Common Basic Principles for Immigrant Integration Policy community-based sponsorship Community preference community sponsorship programme complementary pathway for admission of refugees to third countries complimentary pathway for refugee admission compulsory labour compulsory return compulsory work concept of safe country of origin conditions of detention contract worker Convention implementing the Schengen Agreement Convention on the Rights of the Child Convention relating to the Status of Refugees cooperation platform country information country of first asylum CRC cross-border commuter CSDP cultural assimilation cutting EMN ASYLUM AND MIGRATION GLOSSARY 10.0 76, 104 78 323 290 95 95 111 103 104 251 97 107 107 107 109 129 309, 323 346 348 126 110 113 601 113 114 114 259 263 259 521 150 117 525 602 274 120 126 256 602 132 112 59 251
decision-maker deportation deportation order detention centre detention conditions detention guarantees detention standards determining asylum authority distribution of applicants for international protection Dublin responsibility criteria duty to cooperate EAP EASO EBCGA ECHR economic refugee ECtHR education for immigrant children education for migrant children EES EGN EIN emergency relocation EMF EMLO EMN eMRTD ENP environmentally-driven migrant environmental refugee ePassport equal opportunities establishment of identity for international protection establishment of identity of individuals in international protection procedures ethnicity ETIAS EUAA EU acquis EU Agency for Asylum EU-CELAC MD EU Charter of Fundamental Rights EU citizen EU Emergency Trust Fund for Africa 95 494 495 148 150 150 150 152 158 161 425 166 200 202 206 167 207 445 445 178 208 210 169, 490 211 212 214 68 216 182 182 68 448 184 184 187 219 220 599 220 195 100 600 229 EU Fundamental Rights Charter EU-Horn of Africa-Migration Route Initiative EUIP EU mobility EU Return Coordinator EUR-LO Euro-African Dialogue on Migration and Development Euro-African Ministerial Conference on Migration and Development Eurojust EUROMED European Agency for the Management of Operational Cooperation at the External Borders of the Member States of the European Union European Asylum Support Office European Convention for the Protection of Human Rights and Fundamental Freedoms European Court of Justice European Fundamental Rights Agency European Guardianship Network European Integration Network European Migration Forum European migration liaison officer European Migration Network European Police Office European return liaison officer European travel document for the return of illegally staying third-country nationals European Union Agency for Asylum European Union Agency for Criminal Justice Cooperation European Union Charter of Fundamental Rights European Union Emergency Trust Fund for stability and addressing root causes of irregular migration and displaced persons in Africa European Union - Latin America and the Carribbean structured and comprehensive bi-regional Dialogue on Migration (EU-CELAC MD) EUROSUR EU talent partnership EUTF for Africa ex nunc examination expulsion order FADO failed applicant of international protection failed asylum seeker EMN ASYLUM AND MIGRATION GLOSSARY 10.0 100 354 191 342 507 217 459 459 223 198 202 200 206 129 224 208 210 211 212 214 227 217 218 220 223 100 229 195 205 577 229 234 238 242 489 489 635
false identity document false travel document family reunion family unity female circumcision FGM first asylum principle forced return monitoring system forced return monitoring tool foreigner foreign worker forged identity document forged travel document formal decision FRA fraudulent identity document fraudulent travel document freedom of movement free movement Frontex Fundamental Rights Agency GAM GAMM GBV GDISC gender-based violence gender-related persecution gender-specific harm gender-specific persecution Geneva Convention of 1951 and Protocol of 1967 Geneva Refugee Convention and New York Protocol geographic restriction on residence GFMD Global Approach to Migration grounds for persecution guarantees for detention habitual residence healthcare benefits High-Level Network for Returns High Level Network on Return highly qualified migrant worker highly skilled migrant HLWG Hotspot Standard Operating Procedures (H-SOPs) 636 266 266 249 518 251 251 256 264 264 48 392 266 266 320 224 266 266 519 342 202 224 276 276 272 273 272 271 272 271 274 274 58 278 276 118 150 605 20 287 287 290 290 288 559 Hotspot System H-SOPs human trafficking IBM ICAO format ICONet ID card ID document Identity card IDP IFA IGC illegal entry illegal immigration illegal migrant illegal migration illegal stay ILO Immigrant immigrant labour market integration immigrant population Immigration imposter inculturation information and awareness raising campaign on the risk of irregular migration information on third countries insufficiently documented migrant integration of migrants into the labour market interculturalism intercultural mediator Inter-EU migration internal border internal flight alternative internal protection alternative internal relocation alternative internal Schengen border international protection determination procedure international protection recognition rate international refugee law interview in an asylum context intra EU / EFTA-mobility Intra-EU migration IOM IPA EMN ASYLUM AND MIGRATION GLOSSARY 10.0 295 559 591 209 337 325 308 308 308 336 335 333 344 348 346 348 350 316 314 356 391 315 319 27 71 126 346 356 412 135 342 334 335 335 335 334 450 473 479 439 342 342 338 335
IRMA 349 irregular migration awareness raising campaign 71 irregular secondary movement of migrants 531 ius sanguinis 351 joint return operation 511 JRO 511 jus sanguinis 351 jus soli 352 JVAP 353 labour migrant 392 LADO 362 language and speech analysis for the 362 determination of origin language course 363 legal avenue 366 legalisation 484 legal representative 499 LGB 368 LGBT 368 LGBTIQIA 368 LGBTQ 368 LMT 358 loss of nationality 377 MARRI 405 medical benefits 20 membership of a particular social group 432 migrant in an irregular siuation 346 migrant smuggling 548 migrant with irregular status 346 migration management 379 migratory flow 398 MIM 413 MIPEX 390 MME Partnership 45 MP 411 MRA 414 MTM 153 multiple citizenship 159 multiple nationality 159 mutual information mechanism concerning 413 Member States’ measures in the area of asylum and immigration national cooperation mechanism 416 nationality 106, 187 national liaison officer 316 NCPI 415 non-citizen non-deportable non-national non-removable irregular migrant NRM objective grounds for seeking asylum occurring after the applicant’s departure from their country of origin obligation to leave obligation to return obligatory residence origin verification overstay permanent migration permanent-type migration personal interview person in a migratory context person of migrant origin positive action PRADO Prague Process -Building Migration Partnerships prima facie determination of refugee status principle of equality of arms principle of family unity principle of the best interest(s) of the child procedural safeguards Programme refugee protection determination procedure push-back, pushback push back at sea quota refugee RABIT RDPP reasons for persecution receiving country reception class recognised refugee recognised responsible adult Reform Treaty Refugee Convention refugee determination procedure regional protection programme (RPP) regular migration rejected applicant repatriation support EMN ASYLUM AND MIGRATION GLOSSARY 10.0 48 423 48 423 416 481 509 509 58 184 430 374 374 439 438 438 441 453 444 279 183 518 76 449 501 450 455 455 501 462 483 118 291 445 119 282 369 274 450 483 365 489 498 637
resettled person residence condition residence obligation residence rule responsibility criteria in the context of the Dublin Regulation responsible adult return migration return monitoring return programme reverse brain drain right to appeal right to grant asylum right to remain pending the decision right to remain pending the examination of an application right to reside right to seek asylum RPP RSD procedure SAR operation Schengen Visa Code SCIFA seasonal migrant seasonal worker migrant secondary migrant secondary movement of asylum seekers and refugees second-generation immigrant second-generation Schengen Information System short-term visa SIRENE SIS SIS II skill matching Smart Borders social-cultural orientation course social-cultural orientation training social group Söderköping Process speech-text-analysis speedy asylum procedure speedy international protection procedure sponsorship state liaison officer state of nationality 638 501 58 58 58 161 282 506 264 61 87 515 513 573 573 514 516 483 450 529 610 568 530 530 531 531 532 527 539 545 527 527 359 546 107 107 432 166 362 15 15 113 316 124 state of origin stock of migrants Stronger and Smarter Information Systems for Borders and Security subjective grounds for seeking asylum based on the applicant’s activities in their host country successful return supervision Supplementary Information Request at the National Entries Bureau suspension of removal sustainable reintegration Take back notification Talent Pool TCN temporary international relocation initiative temporary suspension of removal third-country information third-country national mobility TIRI tolerated stay transition class transit visa Treaty of Lisbon UAM UASC UfM unaccompanied and separated child unauthorised crossing of the external EU border unauthorised migrant unauthorised migration UNCRC undesirable and non-removable migrant undocumented migrant undocumented migration UNHCR Union for the Mediterranean Valetta Joint Action Plan Valetta Summit Action Plan VIS visa on humanitarian grounds voluntary repatriation welcome class Western Mediterranean Forum Zaragosa Declaration Zaragoza indicators EMN ASYLUM AND MIGRATION GLOSSARY 10.0 125 391 546 481 574 426 545 443 574 575 194 587 580 443 126 342 580 443 445 539 369 597 597 198 597 344 346 348 602 423 346 348 603 198 353 353 612 302 614 445 258 625 328
EMN ASYLUM AND MIGRATION GLOSSARY 10.0 639
List of synonyms (referenced) 5+5 Dialogue see Five plus Five (5+5) Dialogue on Migration in the Western Mediterranean asylum case worker see case worker in procedures for international protection 1951 Convention Relating to the Status of Refugees and the 1967 Protocol Relating to the Status of Refugees see Geneva Refugee Convention and Protocol asylum claim see application for asylum 1951 Geneva Convention see Geneva Refugee Convention and Protocol asylum determination officer see case worker in procedures for international protection 1951 Refugee Convention see Geneva Refugee Convention and Protocol asylum interview see personal interview for international protection ABC see Automated Border Control (ABC) asylum procedure see procedure for international protection accelerated procedure for international protection see accelerated international protection procedure asylum recognition rate see recognition rate (in procedures for international protection) access to the labour market see access to employment accompanied minor see accompanied child ACP see Africa Caribbean Pacific (ACP) Observatory on Migration ACP Observatory on Migration see Africa Caribbean Pacific (ACP) Observatory on Migration acquis see Union acquis advance passenger data see advance passenger information (API) Advance Passenger Information System see advance passenger information (API) affirmative action see positive discrimination AFIS see Automated Fingerprint Identification System (AFIS) Africa-EU MME Partnership see Africa-EU Migration, Mobility and Employment Partnership AMIF see Asylum, Migration and Integration Fund (AMIF) amnesty (in the context of migration) see regularisation API see advance passenger information (API) APIS see advance passenger information (API) ASEM see Asia-Europe Meeting (ASEM) asylum application see application for asylum 640 automated border control system see Automated Border Control (ABC) Automated Fingerprint Identification System see Automated Fingerprint Identification System (AFIS) AVR assisted voluntary return and reintegration see assisted voluntary return and reintegration programme (AVRR) AVR assisted voluntary return and reintegration package see assisted voluntary return and reintegration programme (AVRR) AVVR see assisted voluntary return and reintegration programme (AVRR) awareness raising and information campaign on migration see awareness raising campaign on the risk of irregular migration Bali Process on People Smuggling, Trafficking in Persons and Related Transnational Crime see Bali Process Barcelona Process see Euro-Mediterranean Partnership (EUROMED) beneficiary of temporary protection see person enjoying temporary protection best interest of the child see best interests of the child (BIC) best interests of the child assessment see child’s best interests assessment (BIA) best interests of the child determination see child’s best interests determination (BID) BIA see child’s best interests assessment (BIA) BIC see best interests of the child (BIC) EMN ASYLUM AND MIGRATION GLOSSARY 10.0
biometrics see biometric data community sponsorship programme see community sponsorship black market see informal economy complementary pathway for admission of refugees to third countries see complementary pathway for admission to third countries business migrant see highly qualified migrant complimentary pathway for refugee admission see complementary pathway for admission to third countries case officer see case worker in procedures for international protection compulsory labour see forced labour case worker see case worker in procedures for international protection compulsory return see forced return CEAS see Common European Asylum System (CEAS) compulsory work see forced labour child’s best interests assessment see child’s best interests assessment (BIA) concept of safe country of origin see safe country of origin child’s best interests determination see child’s best interests determination (BID) conditions of detention see detention circumcision see female genital mutilation CIREFI see Centre for Information, Discussion and Exchange on the Crossing of Frontiers and Immigration (CIREFI) Civic-cultural training see civic orientation course Convention relating to the Status of Refugees see Geneva Refugee Convention and Protocol civic training see civic orientation course cooperation platform see Cooperation Platform on Migration and Development (civil) war refugee see civil war refugee country information see country of origin information (COI) CJEU see Court of Justice of the European Union (CJEU) country of first asylum see first country of asylum clandestine employment see illegal employment see informal economy CRC see United Nations Convention on the Rights of the Child (UNCRC) clandestine migrant see irregular migrant cross-border commuter see cross-border worker clandestine migration see irregular migration CSDP see Common Security and Defence Policy (CSDP) COI see country of origin information (COI) Common Basic Principles for Immigrant Integration Policy see Common Basic Principles Community preference see union preference Convention implementing the Schengen Agreement see Schengen Convention Convention on the Rights of the Child see United Nations Convention on the Rights of the Child (UNCRC) Civic orientation course see civic orientation course community-based sponsorship see community sponsorship contract worker see contract migrant worker cultural assimilation see assimilation cutting see female genital mutilation decision-maker see case worker in procedures for international protection EMN ASYLUM AND MIGRATION GLOSSARY 10.0 641
deportation see removal EMLO see European migration liaison officer (EMLO) deportation order see removal order EMN see European Migration Network (EMN) detention centre see detention facility eMRTD see Automated Border Control (ABC) detention conditions see detention standards and conditions ENP see European Neighbourhood Policy (ENP) detention guarantees see detention standards and conditions environmentally-driven migrant see environmentally displaced person detention standards see detention standards and conditions environmental refugee see environmentally displaced person determining asylum authority see determining authority ePassport see Automated Border Control (ABC) distribution of applicants for international protection see distribution key equal opportunities see principle of equal treatment Dublin responsibility criteria see Dublin criteria establishment of identity for international protection see establishment of identity duty to cooperate see obligation to cooperate establishment of identity of individuals in international protection procedures see establishment of identity EAP see Eastern Partnership (EAP) EASO see European Asylum Support Office (EASO) EBCGA see European Border and Coast Guard Agency (Frontex) ECHR see European Convention on Human Rights (ECHR) economic refugee see economic migrant ECtHR see European Court of Human Rights (ECtHR) education for immigrant children see preparatory class education for migrant children see preparatory class EES see Entry/Exit System (EES) EGN see European Guardianship Network (EGN) EIN see European Integration Network (EIN) emergency relocation see emergency response system emergency relocation see relocation EMF see European Migration Forum (EMF) 642 ethnicity see ethnic nationality ETIAS see European Travel Information and Authorisation System (ETIAS) EUAA see European Union Agency for Asylum (EUAA) EU acquis see Union acquis EU Agency for Asylum see European Union Agency for Asylum (EUAA) EU-CELAC MD see EU-LAC Structured Dialogue on Migration EU Charter of Fundamental Rights see Charter of Fundamental Rights of the European Union EU citizen see union citizen EU Emergency Trust Fund for Africa see European Union Emergency Trust Fund for Africa (EUTF for Africa) EU Fundamental Rights Charter see Charter of Fundamental Rights of the European Union EU-Horn of Africa-Migration Route Initiative see Khartoum Process EUIP see EU Immigration Portal EMN ASYLUM AND MIGRATION GLOSSARY 10.0
European Union Agency for Criminal Justice Cooperation see European Union Agency for Criminal Justice Cooperation (Eurojust) EU mobility see intra-EU mobility EU Return Coordinator see Return Coordinator European Union Charter of Fundamental Rights see Charter of Fundamental Rights of the European Union EUR-LO see European return liaison officer (EURLO) European Union Emergency Trust Fund for stability and addressing root causes of irregular migration and displaced persons in Africa see European Union Emergency Trust Fund for Africa (EUTF for Africa) Euro-African Dialogue on Migration and Development see Rabat Process Euro-African Ministerial Conference on Migration and Development see Rabat Process European Union - Latin America and the Carribbean structured and comprehensive bi-regional Dialogue on Migration (EU-CELAC MD) see EU-LAC Structured Dialogue on Migration Eurojust see European Union Agency for Criminal Justice Cooperation (Eurojust) EUROMED see Euro-Mediterranean Partnership (EUROMED) European Agency for the Management of Operational Cooperation at the External Borders of the Member States of the European Union see European Agenda on Migration European Asylum Support Office see European Asylum Support Office (EASO) EU talent partnership see talent partnership EUTF for Africa see European Union Emergency Trust Fund for Africa (EUTF for Africa) ex nunc examination see ex-nunc examination European Convention for the Protection of Human Rights and Fundamental Freedoms see European Convention on Human Rights (ECHR) expulsion order see expulsion decision European Court of Justice see Court of Justice of the European Union (CJEU) FADO see False and Authentic Documents Online (FADO) European Fundamental Rights Agency see European Union Agency for Fundamental Rights (FRA) failed applicant of international protection see rejected applicant for international protection failed asylum seeker see rejected applicant for international protection European Guardianship Network see European Guardianship Network (EGN) false identity document see fraudulent travel or identity document European Integration Network see European Integration Network (EIN) false travel document see fraudulent travel or identity document European Migration Forum see European Migration Forum (EMF) family reunion see family reunification European migration liaison officer see European migration liaison officer (EMLO) family unity see right to family unity European Migration Network see European Migration Network (EMN) female circumcision see female genital mutilation European Police Office see European return liaison officer (EURLO) FGM see female genital mutilation European return liaison officer see European return liaison officer (EURLO) European travel document for the return of illegally staying third-country nationals see European travel document for return European Union Agency for Asylum see European Union Agency for Asylum (EUAA) EUROSUR see European Border Surveillance System (EUROSUR) first asylum principle see first country of asylum forced return monitoring system see forced return monitoring forced return monitoring tool see forced return monitoring EMN ASYLUM AND MIGRATION GLOSSARY 10.0 643
foreigner see alien Geneva Refugee Convention and New York Protocol see Geneva Refugee Convention and Protocol foreign worker see migrant worker geographic restriction on residence see assigned area of residence forged identity document see fraudulent travel or identity document GFMD see Global Forum on Migration and Development (GFMD) forged travel document see fraudulent travel or identity document formal decision see inadmissible application for international protection FRA see European Union Agency for Fundamental Rights (FRA) Global Approach to Migration see Global Approach to Migration and Mobility (GAMM) grounds for persecution see Convention grounds for persecution guarantees for detention see detention standards and conditions fraudulent identity document see fraudulent travel or identity document habitual residence see usual residence fraudulent travel document see fraudulent travel or identity document healthcare benefits see access to healthcare freedom of movement see right to free movement High-Level Network for Returns see High-Level Network for Return free movement see intra-EU mobility High Level Network on Return see High-Level Network for Return Frontex see European Border and Coast Guard Agency (Frontex) highly qualified migrant worker see highly qualified migrant Fundamental Rights Agency see European Union Agency for Fundamental Rights (FRA) GAM see Global Approach to Migration and Mobility (GAMM) GAMM see Global Approach to Migration and Mobility (GAMM) GBV see gender-specific violence GDISC see General Directors’ Immigration Services Conference (GDISC) gender-based violence see gender-specific violence gender-related persecution see gender-based persecution gender-specific harm see gender-specific violence gender-specific persecution see gender-based persecution Geneva Convention of 1951 and Protocol of 1967 see Geneva Refugee Convention and Protocol 644 highly skilled migrant see highly qualified migrant HLWG see High-Level Working Group (HLWG) on Asylum and Migration Hotspot Standard Operating Procedures (H-SOPs) see standard operating procedures applicable in hotspots Hotspot System see hotspot approach H-SOPs see standard operating procedures applicable in hotspots human trafficking see trafficking in human beings IBM see European integrated border management ICAO format see International Civil Aviation Organisation (ICAO) format ICONet see Information and Coordination Network for Member States’ Migration Management Services (ICONet) ID card see identity document EMN ASYLUM AND MIGRATION GLOSSARY 10.0
ID document see identity document Inter-EU migration see intra-EU mobility Identity card see identity document internal border see internal EU border IDP see internally displaced person internal flight alternative see internal protection IFA see internal protection internal protection alternative see internal protection IGC see Intergovernmental Consultations on Migration, Asylum and Refugees (IGC) internal relocation alternative see internal protection internal Schengen border see internal EU border illegal entry see irregular entry international protection determination procedure see procedure for international protection illegal immigration see irregular migration illegal migrant see irregular migrant international protection recognition rate see recognition rate (in procedures for international protection) illegal migration see irregular migration international refugee law see refugee law illegal stay see irregular stay interview in an asylum context see personal interview for international protection ILO see Immigration Liaison Officer (ILO) intra EU / EFTA-mobility see intra-EU mobility Immigrant see immigrant Intra-EU migration see intra-EU mobility immigrant labour market integration see labour market integration IOM see International Organization for Migration (IOM) immigrant population see migrant stock IPA see internal protection Immigration see immigration IRMA see Irregular Migration Management Application (IRMA) imposter see impostor inculturation see acculturation irregular migration awareness raising campaign see awareness raising campaign on the risk of irregular migration information and awareness raising campaign on the risk of irregular migration see awareness raising campaign on the risk of irregular migration irregular secondary movement of migrants see secondary movement of migrants ius sanguinis see ius sanguinis information on third countries see country of origin information (COI) joint return operation see return operation insufficiently documented migrant see irregular migrant JRO see return operation integration of migrants into the labour market see labour market integration jus sanguinis see ius sanguinis interculturalism see multiculturalism jus soli see ius soli intercultural mediator see cultural mediator JVAP see Joint Valletta Action Plan (JVAP) EMN ASYLUM AND MIGRATION GLOSSARY 10.0 645
labour migrant see migrant worker MIPEX see Migrant Integration Policy Index (MIPEX) LADO see language analysis for the determination of origin (LADO) MME Partnership see Africa-EU Migration, Mobility and Employment Partnership language and speech analysis for the determination of origin see language analysis for the determination of origin (LADO) MP see mobility partnership language course see language training MTM see Dialogue on Mediterranean Transit Migration legal avenue see legal pathway legalisation see regularisation legal representative see representative LGB see LGBTIQ LGBT see LGBTIQ LGBTIQIA see LGBTIQ LGBTQ see LGBTIQ LMT see labour market test loss of nationality see loss of citizenship MARRI see Migration, Asylum, Refugees Regional Initiative (MARRI) medical benefits see access to healthcare membership of a particular social group see particular social group migrant in an irregular siuation see irregular migrant migrant smuggling see smuggling of migrants migrant with irregular status see irregular migrant migration management see managed migration migratory flow see migration flow MIM see mutual information mechanism 646 MRA see mutual recognition agreement multiple citizenship see dual citizenship multiple nationality see dual citizenship mutual information mechanism concerning Member States’ measures in the area of asylum and immigration see mutual information mechanism national cooperation mechanism see national referral mechanism nationality see citizenship nationality see ethnic nationality national liaison officer see Immigration Liaison Officer (ILO) NCPI see National Contact Points on Integration non-citizen see alien non-deportable see non-removable returnee non-national see alien non-removable irregular migrant see non-removable returnee NRM see national referral mechanism objective grounds for seeking asylum occurring after the applicant’s departure from their country of origin see refugee sur place obligation to leave see return decision obligation to return see return decision obligatory residence see assigned area of residence origin verification see establishment of identity EMN ASYLUM AND MIGRATION GLOSSARY 10.0
overstay see overstayer receiving country see host country permanent migration see long-term migration reception class see preparatory class permanent-type migration see long-term migration recognised refugee see Convention refugee personal interview see personal interview for international protection recognised responsible adult see guardian person in a migratory context see person with a migratory background Reform Treaty see Lisbon Treaty person of migrant origin see person with a migratory background Refugee Convention see Geneva Refugee Convention and Protocol positive action see positive discrimination refugee determination procedure see procedure for international protection PRADO see Public Register of Authentic Travel and Identity Documents Online (PRADO) regional protection programme (RPP) see regional development and protection programme (RDPP) Prague Process -Building Migration Partnerships see Prague Process regular migration see legal migration prima facie determination of refugee status see group determination of refugee status rejected applicant see rejected applicant for international protection principle of equality of arms see equality of arms repatriation support see repatriation assistance principle of family unity see right to family unity resettled person see resettled refugee principle of the best interest(s) of the child see best interests of the child (BIC) residence condition see assigned area of residence procedural safeguards see procedural guarantees residence obligation see assigned area of residence Programme refugee see resettled refugee residence rule see assigned area of residence protection determination procedure see procedure for international protection responsibility criteria in the context of the Dublin Regulation see Dublin criteria push-back see push back responsible adult see guardian pushback see push back return migration see return push back at sea see push back return monitoring see forced return monitoring quota refugee see resettled refugee return programme see assisted voluntary return and reintegration programme (AVRR) RABIT see Rapid Border Intervention Team (RABIT) RDPP see regional development and protection programme (RDPP) reasons for persecution see Convention grounds for persecution reverse brain drain see brain gain right to appeal see right to an effective remedy right to grant asylum see right of asylum EMN ASYLUM AND MIGRATION GLOSSARY 10.0 647
right to remain pending the decision see suspensive effect social group see particular social group right to remain pending the examination of an application see suspensive effect Söderköping Process see Eastern Partnership (EAP) right to reside see right of residence speech-text-analysis see language analysis for the determination of origin (LADO) right to seek asylum see right to asylum RPP see regional development and protection programme (RDPP) speedy asylum procedure see accelerated international protection procedure speedy international protection procedure see accelerated international protection procedure RSD procedure see procedure for international protection sponsorship see community sponsorship SAR operation see search and rescue (SAR) operation state liaison officer see Immigration Liaison Officer (ILO) Schengen Visa Code see Visa Code state of nationality see country of nationality SCIFA see Strategic Committee on Immigration, Frontiers and Asylum (SCIFA) state of origin see country of origin seasonal migrant see seasonal worker seasonal worker migrant see seasonal worker secondary migrant see secondary movement of migrants secondary movement of asylum seekers and refugees see secondary movement of migrants second-generation immigrant see second-generation migrant second-generation Schengen Information System see Schengen Information System (SIS) short-term visa see short-stay visa SIRENE see Sirene Bureau SIS see Schengen Information System (SIS) SIS II see Schengen Information System (SIS) skill matching see labour matching Smart Borders see Smart Borders Package social-cultural orientation course see civic orientation course social-cultural orientation training see civic orientation course 648 stock of migrants see migrant stock Stronger and Smarter Information Systems for Borders and Security see Smart Borders Package subjective grounds for seeking asylum based on the applicant’s activities in their host country see refugee sur place successful return see sustainable return supervision see obligation to report Supplementary Information Request at the National Entries Bureau see Sirene Bureau suspension of removal see postponement of removal sustainable reintegration see sustainable return Take back notification see take back request Talent Pool see EU Talent Pool TCN see third-country national temporary international relocation initiative see temporary international relocation initiative (TIRI) temporary suspension of removal see postponement of removal EMN ASYLUM AND MIGRATION GLOSSARY 10.0
third-country information see country of origin information (COI) visa on humanitarian grounds see humanitarian visa third-country national mobility see intra-EU mobility voluntary repatriation see voluntary return TIRI see temporary international relocation initiative (TIRI) welcome class see preparatory class tolerated stay see postponement of removal Western Mediterranean Forum see Five plus Five (5+5) Dialogue on Migration in the Western Mediterranean transition class see preparatory class transit visa see short-stay visa Treaty of Lisbon see Lisbon Treaty Zaragosa Declaration see Zaragoza Declaration on Integration Zaragoza indicators see integration indicators UAM see unaccompanied minor UASC see unaccompanied minor UfM see Euro-Mediterranean Partnership (EUROMED) unaccompanied and separated child see unaccompanied minor unauthorised crossing of the external EU border see irregular entry unauthorised migrant see irregular migrant unauthorised migration see irregular migration UNCRC see United Nations Convention on the Rights of the Child (UNCRC) undesirable and non-removable migrant see non-removable returnee undocumented migrant see irregular migrant undocumented migration see irregular migration UNHCR see United Nations High Commissioner for Refugees (UNHCR) Union for the Mediterranean see Euro-Mediterranean Partnership (EUROMED) Valetta Joint Action Plan see Joint Valletta Action Plan (JVAP) Valetta Summit Action Plan see Joint Valletta Action Plan (JVAP) VIS see Visa Information System (VIS) EMN ASYLUM AND MIGRATION GLOSSARY 10.0 649
European Migration Network For more information EMN website: http://ec.europa.eu/emn EMN LinkedIn page: https://www.linkedin.com/company/european-migration-network EMN X account: https://x.com/emnmigration EMN YouTube channel: https://www.youtube.com/@EMNMigration EMN National Contact Points Austria www.emn.at/en/ Belgium www.emnbelgium.be/ Bulgaria www.emn-bg.com/ Croatia emn.gov.hr/ Cyprus www.moi.gov.cy/moi/crmd/emnncpc.nsf/ home/home?opendocument Czech Republic www.emncz.eu/ Estonia www.emn.ee/ Finland emn.fi/en/ France www.immigration.interieur.gouv.fr/ Europe-et-International/Le-reseau-europeen-des-migrations-REM3/Le-reseau-europeen-des-migrations-REM2 Germany www.bamf.de/EN/Themen/EMN/emnnode.html Greece https://migration.gov.gr/emn/ Hungary www.emnhungary.hu/en Ireland www.emn.ie/ Italy www.emnitalyncp.it/ Latvia www.emn.lv Lithuania www.emn.lt/ Luxembourg emnluxembourg.uni.lu/ Malta emn.gov.mt/ The Netherlands www.emnnetherlands.nl/ Poland www.gov.pl/web/european-migration-network Portugal rem.sef.pt/en/ Romania www.mai.gov.ro/ Spain www.emnspain.gob.es/en/home Slovak Republic www.emn.sk/en Slovenia emnslovenia.si Sweden www.emnsweden.se/ Norway www.udi.no/en/statistics-and-analysis/ european-migration-network---norway# Georgia migration.commission.ge/ Republic of Moldova bma.gov.md/en Ukraine dmsu.gov.ua/en-home.html Montenegro www.gov.me/mup Armenia migration.am/?lang=en Serbia kirs.gov.rs/eng North Macedonia