Текст
                    Shower
secrets
MAKE YOUR
SHOWER A
WINNER

+
BATHING
SANCTUARIES

Get It Right
With Expert
Advice
Image courtesy of DiSegno Casa

No. 01

AUS $14.95*
NZ $14.95
(Both incl. GST)

THE WOW FACTOR
Statement features, nostalgic luxury,
trendsetting warm metals and matte finishes



UNDERFLOOR HEATING
1300 794 488 brindabella.net.au
Bathrooms - Renovations - Constructions
DRUMMOYNE: 5-6/50 Victoria Road, Drummoyne NSW Tel (02) 9819 6915 PENNANT HILLS: 370 Pennant Hills Road, Pennant Hills NSW Tel (02) 9483 2222 SEVEN HILLS: 5 Foundry Road, Seven Hills NSW Tel (02) 8824 2310
impalakitchens.com.au
AUSTRALIAN DESIGNED AND BEAUTIFULLY CRAFTED, OMVIVO ARE LEADERS IN UNIQUE CONTEMPORARY BATHROOM PRODUCTS. Clockwise from left: Lune Bath Lune 550 Above Counter Basin MOD 1200 Wall Basin Stadium Sub Undermount Basin Opposite: Marrakech with Mirror and Splash Back

FUTURE READY Lead-Free Stainless Steel Tapware Engineered for Tomorrow’s Standards Experience the perfect blend of sophistication and eco-consciousness with KOVA Lead Free Stainless Steel TAPWARE. Available in two stunning ३nishes: the timeless allure of natural Brushed Stainless Steel and the sleek sophistication of PVD Gunmetal. Choosing lead-free and low lead materials is the pathway to a future of clean water and healthier living. INNOVA’s way towards a cleaner, more environmentally friendly world. ,1129$E\%HVWOLQN,QWHUQDWLRQDO_/DWLWXGH%RXOHOYDUG7KRPDVWRZQ9LF_ EHVWOLQNFRPDX_,QVWDJUDPFRPLQQRYDBEDWKZDUH
Merging style with sustainability seamlessly
CONTENTS 24 REGULARS 18 138 From the Editor Index INTERNATIONAL SHOWCASE 24 Scandinavian superiority Demonstrating Scandi style at its best, this humble abode is a warm and inviting tapestry of warmth and tactility 29 Tiny house triumph A heritage dwelling gets a makeover that maximises space and ensures functionality for a new generation 34 Dark & divinely designed Located on the Rue de la Commune, this pied-à-terre resides in a historical and coveted area of Old Montreal 12 COMPLETEHOME.COM.AU 29

SPECIAL FEATURES 72 Ask the experts The Kitchen & Bathroom Designers 20 40 50 60 62 A silica-free solution Explore safe surface options for your kitchen and bathroom that are sure to dazzle Quiet luxury To create a look that is always restful and enduringly elegant, pair warmtoned metallics with matt ȴnishes Shower secrets We’ve got the inside scoop on all you need to know to make your shower space a winner Leading the way Bathroom experts Omvivo share their thoughts on the power of solid surface materials Nostalgic luxury Your go-to guide for blending heritage features and modern elements to make a statement 40 14 COMPLETEHOME.COM.AU Institute (KBDi) has written the rule book on bathroom design BATHROOM SHOWCASE 80 Earthy wonder GT&B 84 Coastal calm Impala Kitchens & Bathrooms 87 Spa luxe Rosemount Kitchens 90 Simply a dream GT&B 94 Fluted & fabulous Bathrooms by Oldham 98 A robust retreat Robert Bayly Design
Kitchen Bathroom and Laundry 797 sandgate road, clayfield p 07 3862 3855 Kitchen and Laundry 79 stewart road, ashgrove p 07 3366 4041 (appliances only) Since 1975, Stocks Designer Appliances & Bathrooms has been family owned and operated. Our team, our service, and our showrooms reflect this family heritage. Let us help you to create your family’s heritage in your new build or renovation project. Select and specify from our stunning ranges of beautiful kitchen and luxury laundry appliances. Visit our Clayfield showroom to view our selection of perfect bathroomware from Europe and Australia.
PRODUCT AND PROFILE SHOWCASE 104 Beautiful basins Omvivo 107 Powder room specialists Brindabella Bathrooms 110 Style meets tech Greens Tapware 114 Italy within reach Disegno Casa 117 Classic precision Oliveri Solutions 120 Master showroom Hardware & General 122 Functional design, visual excellence Johnson Suisse 126 Making waves at the Good Design Awards Stormtech 129 CREATIVE EDITS 128 131 134 Tub time Basin bonanza Turn up the style 134 16 COMPLETEHOME.COM.AU
Sleek Stylish Sophisticated GALIANO Timeless Elegance.
FROM THE EDITOR Editor Nicole Mulloy Deputy Editor Catherine Falalis Sub-editor Michelle Segal Designer Sarah Bryant Prepress Ivan Fitz-Gerald Contributors Karen Booth, Nishi Amaratunga, Carrol Baker, Karsha Green Photographers Ansh Bose, Andrew Lecky Cover Image courtesy of Disegno Casa. disegnocasa.com.au Bathroom products by Disegno Casa COMMERCIAL CONTACTS Nicole NSW Manager Scott Thomson P 0411 424 335 E sthomson@umco.com.au WA Manager Licia Salomone P 0412 080 600 E licia@okm.com.au Vic & SA Manager John Oliver P 0417 316 820 E joliver@umco.com.au NZ Manager John Williams P 022 455 8821 E john@createcontent.co.nz Nicole Mulloy | Editor A s you ȵip through the pages of this year’s Bathroom Yearbook, you’ll begin to notice the focus on design and sustainability in bathrooms. Inspiration from the ‘natural’ world is dominating, with earth tones taking centre stage. Rich, heavily saturated splashes of colour are also becoming popular as people steer away from sterile white zones and settle into warm and intimate spaces. Character is key in bathrooms these days! Given the tendency over the past few years to view our bathrooms as the sanctuaries they are, it’s not surprising to ȴnd warm lighting, textured stone and rich metals ȴnding their way into our bathing habitats. If you want to know more about these growing trends, head over to page 44 for our feature on warm metals and matt ȴnishes to discover how to create enduring elegance in your bathroom. If a good shower is more your style, ȴnd out our shower secrets on page 54 and turn your everyday ritual into a true bathing experience. Perhaps you’re looking for some key ideas to add something unique to your wet room. Try our goto guide on page 66 that showcases how to blend heritage features and modern elements to ȴnd the perfect balance of style and character. Whatever your bathroom renovation or build needs, you’ll ȴnd expert advice and a swathe of inspiring projects within these pages to help you achieve your own aquatic oasis. From product suggestions to tile tips, tapware inspiration to international inȵuences you’ll ȴnd it all in these pages, so settle in for an inspiring read that will help you take your bathroom to the next level. 18 COMPLETEHOME.COM.AU Qld Manager Amy Frank P 0450 195 373 E afrank@umco.com.au Chairman/CEO Prema Perera Publisher Janice Williams Chief Financial Officer Vicky Mahadeva Associate Publisher Emma Perera Circulation Business Development Manager Mark McTaggart Subscriptions & mail orders 1300 303 414 Bathroom Ideas is published by Universal Magazines, Unit 5, 6-8 Byfield Street, North Ryde NSW 2113. Phone (02) 9805 0399, Fax (02) 9805 0714. Melbourne office, Level 1, 150 Albert Road, South Melbourne Vic 3205. Phone (03) 9694 6444, Fax (03) 9699 7890. Printed in Singapore by Times Printers, www.timesprinters.com, distributed by Gordon and Gotch, Australia. Distributed in Singapore and Malaysia by Carkit (FE) Pte Ltd, Singapore. This magazine has content that is advertorial or promotional in nature. This book is copyright. Apart from any fair dealing for the purpose of private study, research, criticism or review as permitted under the Copyright Act, no part may be reproduced by any process without written permission. Enquiries should be addressed to the publishers. The publishers believe all the information supplied in this book to be correct at the time of printing. They are not, however, in a position to make a guarantee to this effect and accept no liability in the event of any information proving inaccurate. Prices, addresses and phone numbers were, after investigation and to the best of our knowledge and belief, up to date at the time of printing, but the shifting sands of time may change them in some cases. It is not possible for the publishers to ensure that advertisements that appear in this publication comply with the Competition and Consumer Act 2010 (Cth) and the Australian Consumer Law. The responsibility must therefore be on the person, company or advertising agency submitting the advertisements for publication. While every endeavour has been made to ensure complete accuracy, the publishers cannot be held responsible for any errors or omissions. * Recommended retail price ISBN 978-1-923257-83-2 Copyright © Universal Magazines MMXXIV Please pass on or recycle this magazine. umco.com.au ACN 003 026 944 Please note that while every effort is made to accurately reproduce colours within this publication, exact colour matching is not possible and we recommend that our readers check specific colours directly with manufacturers.

01 A S IL IC A-F RE E SOLUTION words nicole mulloy 20 COMPLETEHOME.COM.AU
EDITORIAL 02 A s of 1 July 2024, all Australian PORCELAIN states and territories are Porcelain has really come into its own in banning the use, supply and the last couple of years. A popular choice manufacture of engineered for those seeking a silica-free alternative, stone under work health and porcelain is made from natural clay and safety laws. The ban will apply to engineered minerals. A non-porous surface, porcelain stone benchtops, slabs and panels. is durable and resistant to scratching and With the ban on engineered stone staining, o΍ering longevity to interior builds. benchtops imminent, many homeowners are Available in a wide range of colours and turning to silica-free alternatives, but they patterns, porcelain slabs are a versatile and aren’t always aware of their options. In today’s stylish solution for kitchens and bathrooms. market, many companies are releasing new porcelain o΍erings. Laminate has undergone a SOLID SURFACE MATERIALS renaissance with improved looks and features. Looking for something a little more Natural stone never goes out of style, and solid technical? Composed of synthetic surface solutions abound. If you want to stay materials, solid surface products o΍er away from engineered stone products tied to seamless bespoke design options and silicosis concerns, try these options. easy maintenance. Solid surface materials 01 Dekton by Cosentino. cosentino.com 02 Surround by Laminex. laminex.com.au 03 Staron Solid Surface. austaronsurfaces.com.au 03 BATHROOM IDEAS 21
04 22 COMPLETEHOME.COM.AU
EDITORIAL 05 05 04 Staron Solid Surface. austaronsurfaces.com.au 05 Caesarstone porcelain in Libretta & Smokestone. caesarstone.com.au 06 Pietra Kode Dekton from Cosentino. cosentino.com are non-porous and durable, as well as repairable, sustainable and antibacterial, making them a sturdy addition to any busy kitchen or bathroom. LAMINATE A staple in the construction industry for cabinetry and benchtops, laminate has been covering our kitchens, laundries and bathrooms for decades. Renowned for its a΍ordability, laminate is also easy to install and easy to clean. It is moisture and scratch resistant, versatile and a΍ords a range of design options. Available in a rainbow-spectrum of colours and wood grains, laminate makes for a resilient option for counters and joinery. SINTERED STONE A combination of minerals, clays and feldspar, or quartz, porcelain and glass, products such as Neolith and Dekton are a class of materials most commonly referred to as sintered stone. Food safe and hygienic, these stone panels are durable, una΍ected by heat and cold, waterproof, stainproof and easy to clean. O΍ered in a range of patterns and colours, sintered stone is a solid choice for everything from wall panels to countertops, and is even suitable for outdoor use. For more information visit dewr.gov.au/engineeredstone 06 “Engineered stone is widely used in benchtops. It is safe once installed as long as it remains undisturbed (ie. no work is being carried out to remove, repair or modify it). There is no need to remove engineered stone from homes or workplaces, as installed engineered stone does not pose health risks. It is important not to undertake DIY work with engineered stone benchtops though, because cutting, grinding, trimming, drilling, sanding or polishing could generate silica dust that can be harmful when inhaled. Contact a qualified tradesperson instead.” — Australian Government, Department of Employment and Workplace Relations. BATHROOM IDEAS 23
24 COMPLETEHOME.COM.AU
SHOWCASE Opposite page Roughly textured surfaces crafted from a tactile material palette of wood, stone and natural-fibre textiles dominate, while thoughtfully in-built and bespoke details provide balance. words nicole mulloy photography jonas bjerre-poulsen private residence in the idyllic landscape of Northern Zealand in Denmark has received an interior refurbishment by Norm Architects that marries country house charm with contemporary sophistication. A style heavily emulated in the last decade, the simplicity of Scandinavian design is highly evident in the Sandbjerg Residence project. Replete with all the hallmarks of “Scandi” ȵavour, including the use of natural materials such as wood and stone, ample natural light, cosy textiles and clean-lined furniture, this family home reȵects a harmonious and comfortable living environment. Demonstrating Scandi style at its best and most authentic, this humble abode is a warm and inviting tapestry of warmth and tactility SCANDINAVIAN SUPERIORITY BATHROOM IDEAS 25
Above In the living spaces, dark oak and iron elements offer a grounded gravitas that is contrasted in the white oak joinery and lighter stone accoutrements in the master bedroom and bathroom. Right and opposite All materials chosen for the interiors are durable and easily maintained, gaining beauty with time, wear and tear. 26 COMPLETEHOME.COM.AU
SHOWCASE BATHROOM IDEAS 27
Surrounded by meadows and forests, the Above The open layout of the house consists of monochrome spaces seamlessly transitioning into one another, with switching levels and materials defi ning the thresholds and functions of each individual spot. Above right Everything inside is made from the fi nest, largely locally sourced, natural materials. The elegant bar cabinet is designed in lamelled dark oak and blackened iron. house sits intimately secluded in a nook of trees that open up to a park-like garden that brings light and air to the residence. Inside, a simple palette of neutral earthy hues touches every surface, creating a visible connection to nature. In the master bedroom, an open-plan layout leads directly into a large ensuite bathroom. A switch from blonde-wood ȵooring to concretelike tiles signals the shift from sleep quarters to wet room. Wood-panelled walls serve to divide the space and form a walk-in closet that feeds directly into the bathroom – consciously resembling the layout of a hotel suite. In this space, bespoke basins sit atop a stone-topped vanity with soft-curved ends that o΍ set the linear angles prominent throughout the home. White-oak timber lines the vanity, bringing in warmth and texture. Round mirrors and simple exposed bulb lights ȵoat over the brushed nickel tapware, providing a cool contrast to the honey-hued wood. A study in luxurious practicality, this elegantly appointed bathroom represents the best in Scandinavian design. NORM ARCHITECTS normcph.com 28 COMPLETEHOME.COM.AU
SHOWCASE TINY HOUSE TRIUMPH A heritage dwelling gets a makeover that maximises space and ensures functionality for a new generation words nicole mulloy additional ȵoor and complete interior photography mariell lind hansen refurbishment to better meet the needs of the occupants within. n a constrained site in East London, a The upper ȵoors of the terrace now function as an unfolding sequence of rooms. traditional terrace A new shared family bathroom and oɝce- house has received cum-dressing room share the existing upper an expert overhaul level, with the master bedroom and ensuite to accommodate occupying the new top ȵoor. These fresh a growing family with a newborn babe. spaces carry on from a light refurbishment Undertaken by the team at Studio Hagen to the existing kitchen at ground ȵoor, and Hall, this modest dwelling received an connect to the rest of the house via a new BATHROOM IDEAS 29
“We focused closely on the interior architecture, design and detailing to maximise the constrained site for our clients.” 30 COMPLETEHOME.COM.AU
SHOWCASE Previous page A highly designed master bedroom boasts two large, generous roof lights buffered by rich, linen curtains. A redundant chimney stack recess is reappropriated as the master bed nook, holding an in-situ joinery piece featuring high-level storage. This page The earthy material palette in the shared family bathroom brings through a sense of calm, enriched by the soft but highly textural splash of colour added through the inclusion of the quartzite vanity. BATHROOM IDEAS 31
32 COMPLETEHOME.COM.AU
SHOWCASE stair that provides a modern interpretation of the previous one, bringing an elevated and uniȴed palette throughout the house. The clever spatial layout of the family This page The homeowner’s brief was to maximise the available space, bringing to life a light and airy space with capacious storage solutions, executed in a natural and premium material palette with plenty of texture for tactile appeal. bathroom is anchored by an emerald seagreen quartzite vanity. This is framed by elm wood storage panelling, making use of any available vertical surface for added storage. The vanity steps down to form a window seat adjacent to the bathtub, allowing the shower screen to swing wide open and create a niche for the parents at baby’s bathtime. The bath surrounds are lined in microcement, a water-resistant, non-slip material in a light colour. The muted texture of the microcement complements the delicate balance of materials in the space and, together with clay render over existing brickwork on the adjacent walls and terracotta tiles on the ȵoor, makes the bathroom a bright and inviting spot to be in. The earthliness of these materials is contrasted against unlacquered brass ȴttings, bringing a sense of understated luxury into the room. Through the application of a restrained material palette, Studio Hagen Hall has created a pragmatic and poetic zone that gives its clients the freedom to grow and adapt as their needs evolve. STUDIO HAGEN HALL studiohagenhall.com BATHROOM IDEAS 33
34 COMPLETEHOME.COM.AU
SHOWCASE DARK AND DIVINELY DESIGNED words nicole mulloy photography ulysse lemerise-bouchard BATHROOM IDEAS 35
SHOWCASE Images Facing the Saint Lawrence River, the old buildings on this street witnessed the birth of the city nearly 400 years ago. The intricate woodwork and weathered stone walls serve as evocative time capsules, whisking visitors away to a bygone era, admirably preserving its essence and resonating with a soulful connection to its heritage. The authentic stone rubble walls, echoing the area’s rich heritage, evoke a sense of history. Meanwhile, the wood-panelled ceiling exudes a refi ned and subdued ambience, reminiscent of the architectural style prevalent during that era. Every arrangement and connection was meticulously designed to render the space elegant and refi ned. The selection of furniture, integration of artworks and decorative elements breathe life into the surroundings. ocated on the iconic Rue de la century. Upon stepping inside, a vestibule Commune in Montreal, Suite grants a tantalising glimpse of the expansive 201 is a pied-à-terre in the communal area through a subtly smoked historical and coveted area of glass panel. Centred around the concept of Old Montreal. a tavern, the living room, artfully divided into A unique residential build and the brainchild of MU Architecture, Suite 201 was once an erstwhile inn that warmly 36 COMPLETEHOME.COM.AU three distinct zones, seamlessly integrates with the kitchen. The drama of the black-on-black kitchen welcomed labourers and seafarers from the ȵows into a wellness area cleverly concealed bustling Port of Montrel during the mid-19th by a secret door. Inside, a wonderland of
BATHROOM IDEAS 37
SHOWCASE spa facilities that include a steam bath, shower and relaxation platform create a perfect haven for unwinding. Indirect lighting and ceramic surfaces resembling dark stone transport the user to a serene space that seems almost carved into the rock. Smoked glass panels and iroko wood accents further contribute to this tranquil and soothing ambience. Stepping through yet another concealed entrance, a hidden doorway opens into the dressing area adjoining the master bedroom. The allure of more smoked glass partitions guides one towards an intimate bathroom adorned with natural, intricately detailed ȴnishes, evoking an entrancing and soothing atmosphere. The architectural design of this oneof-a-kind abode imbues secrecy into this labyrinthine yet fascinating layout, harmoniously blending functionality with an aesthetic allure to captivate the senses. MU ARCHITECTURE architecture-mu.com 38 COMPLETEHOME.COM.AU
MODULR+ ONLINE VANITIES ENDLESS CONFIGURATIONS, READY IN DAYS Designed for Living, Built for Life info@modulr.com.au modulr.com.au
QUIET LUXURY To create a look that is always restful and enduringly elegant, pair warm-toned metallics with matt finishes words karen booth 40 COMPLETEHOME.COM.AU
FEATURE G b Above Gunmetal from The Curated Finishes Collection pairs with stone and timber. phoenixtapware.com.au Top right Matt Posy Labello sink with natural stone feel and brushed brass tapware. abiinteriors.com.au loss and glam still have their place in the bathroom, but a softer design approach that prioritises warm metal tones, matt ȴnishes, calming natural colours and an earthier elegance has taken hold. Think brushed bronze or copper tapware teamed with a matt-ȴnish concrete or stone basin. The e΍ect is soothing; the look unpretentious. “Tapware and hardware in warm-metal hues with a brushed ȴnish have a beautiful, tactile nature and add a subtle, elegant character to a space that you can’t achieve with more glossy ȴnishes. There’s been a big shift in the interior design industry, with people being drawn to ‘quiet luxury’, and I think warm metals and matt ȴnishes tie into that desire for understated sophistication,” says Fiona Gould, House of Rohl stylist. “Warmer-toned metallic ȴnishes look stellar in modern and traditional-style bathrooms,” says Christie Wood, Beaumont Tiles’ design specialist. “People are enjoying the laid-back luxury of brushed copper or brushed gold tapware and teaming them with non-gloss tiles, bathtubs and more.” It’s a trend, according to Akea Scott, Industrie Tapware interior designer, that’s fuelled by a desire for less fad-ȴxated bathroom designs that emphasise more natural – and restful – materials and ȴnishes. “Homeowners are focused on creating a look that will endure and remain relevant, and engenders a sense of relaxation. Lowmaintenance is important, too,” she says. “When matt ȴnishes emerged, there was scepticism about whether they would be more diɝcult to keep clean compared to gloss or polished ȴnishes. Now we know they are easy to clean and easier to keep looking fresh as the surface reȵects little to no light, thereby hiding any marks. This is just one of the reasons we are seeing a real shift from gloss to matt in tiles, basins, baths and vanity tops, and from polished chrome to metal-coloured tapware with a brushed or textured ȴnish.” BATHROOM IDEAS 41
FEATURE TAP INTO THIS as it’s a ‘living ȴ nish’, it develops a patina looks for tapware include nickel, gold, brass, which, over time, gives character to a gunmetal, copper and bronze with a brushed space,” adds Fiona. “Mixing old and new ȴnish. This ȴnish add sophistication while is a big trend at the moment, so this aged o΍ering a more subdued look than traditional e΍ ect is perfect for modern and traditional shiny chrome,” says Paul Coulson, interior designs. English bronze is another popular designer at Earthborne by Design. “Warm- ȴ nish. It has a rich, chocolate-bronze colour metal ȴnishes are versatile and complement with gold undertones and is also fantastic a variety of bathroom styles. Brushed gold for adding character.” or brass tapware can bring elegance to Top Large-format matt tiles are the backdrop for the warm-toned tapware. earthbornbydesign.com.au Above This Origini palette offers mix-and-match warm bronze, dark bronze and powder pink. gessi.com 42 COMPLETEHOME.COM.AU “Brushed brass is a popular choice and, “Some of the most popular warm-metal And we can’t overlook matt-ȴ nish traditional- or vintage-style bathrooms, while tapware in versatile black and, increasingly, gunmetal and bronze can lend a modern white. “Beautiful brushed brass, golds minimalist aesthetic to contemporary and coppers are strong across so many bathrooms. These ȴnishes can also be used tapware ranges now, as are low-sheen to create a striking contrast in industrial or brushed nickel and gunmetal — also matt eclectic bathroom designs.” black and matt white, with the latter seeing “Brushed nickel and brushed gunmetal, as a resurgence from the ’70s,” says Kirsty well as brass and bronze ȴnishes, can enhance Duncan, interior designer at Bearcanvas both cool and warm palettes while creating Interiors. She adds that an emerging trend a high-end feel,” says Akea. “Brushed nickel to watch out for is the use of punchier and in particular has become a luxury alternative pastel matt hues. “Gessi’s Origini collection, to polished chrome and is a good choice with colours ranging from muted powder for heritage renovations where using black, pink to a rich agave green, is just one gunmetal or bright gold would be too much.” example,” she points out.
This page Brushed brass tapware, Nood basin, and Pompeii Travertine and Clay Chalk tiles. dnaofdesign.com.au BATHROOM IDEAS 43
Top left The Santorini stone-resin bath in a matt white finish with fine fluting. industrietapware.com.au Middle left Continuity of materials soothes the eye and eases the transition from butler’s pantry to laundry. hallhart.au Bottom left Victoria & Albert Radford 51 basin with brassware and matt plaster-effect walls. houseofrohl. com Image India Hobson Opposite Brushed copper tapware and accessories amid a sea of muted matt finishes. birdblackdesign.com.au LUXE UNIFORMITY “The trend of warm-metal colours and nongloss ȴnishes extends to other bathroom ȴttings, including shower hardware and cabinetry handles. This uniȴed approach to design creates a cohesive look,” says Paul. “These ȴnishes, when used throughout a bathroom, add depth and texture to the overall design, and contribute to a more relaxed atmosphere as they soften the visual impact and create a more organic, tactile feel within the space. The result is a modern yet timeless bathroom design that exudes charm while maintaining a sense of practicality.” “Carrying the same warm-metal colour palette across shower sets, cabinetry details and other features is the resounding trend,” adds Christie. “These warmer-toned details create a luxe uniformity. Matt or brushedmetal ȴnishes can then be paired with rustic or textural tiles like travertine, and they suit more natural design themes. Those who love styles like Farmhouse, Mediterranean or Coastal tend to gravitate towards warm brushed metallics. To evoke a biophilic bathroom, stoneware baths, matt concrete basins and honed tiles can be paired with brushed copper tapware and accessories.” A tip for those who want to use the same colour ȴ ttings and hardware throughout is to play with textures. Knurling, where a diamond or mesh-like pattern is rolled into the surface, adds interest and makes taps and handles easier to grip. Or you can use di΍erent tones to mix things up a little. “The fact that metal colours are ȴltering through into all the elements of the bathroom, such as shower hardware, drainage, heated towel ladders and accessories – even mirror frames and lighting – indicates a manufacturing commitment from brands. This proves that colour in bathroom ȴxtures and ȴ ttings is here to stay for quite some time,” says Kirsty. 44 COMPLETEHOME.COM.AU
FEATURE BATHROOM IDEAS 45
BASINS, BATHS AND MORE The growing preference for matt or lowsheen ȴnishes is eminently evident in the latest o΍erings in basins and baths. “One trend is for matt-ȴnish basins, particularly in neutral tones like white, grey, pink, green or black. They bring a sense of sophistication to the bathroom and complement a variety of design styles, from modern to minimalist,” says Paul. “Matt-ȴnish bathtubs, especially in subtle shades like taupe, grey or charcoal, are also gaining attention. They create a luxurious and inviting focal point.” It’s a trend that can also be seen in vanity tops, such as those made of natural or engineered stone … even custom concrete. “These are being increasingly favoured for their tactile appeal. Matt ȴnishes can help minimise the appearance of water spots and ȴngerprints, making them a practical choice 46 COMPLETEHOME.COM.AU
FEATURE as well,” adds Paul. “Overall, the trend for Above This surface by Caesarstone Mineral Surfaces in Solenna brings a little polish to this design. caesarstone.com.au Left A brushed nickel Lina basin mixer complements the industrial look of concrete. beaumont-tiles.com.au Top Right Brushed nickel Bondi wall mixer set, matt white basin combined with the warmth of wood. industrietapware.com.au TALKING TILES matt ȴnishes reȵects a broader shift towards “Matt-ȴnish tiles, whether on the ȵoor or a more understated aesthetic in bathroom walls, are a popular choice for creating a calm design, while their versatility and timeless atmosphere in the bathroom. This trend is appeal make them an attractive choice.” seen in a variety of colours and sizes, with “Matt-ȴnish baths and basins have deȴnitely increased in popularity over those with a gloss ȴnish,” says Fiona. matt subway tiles and large-format matt tiles being particularly popular,” says Paul. According to Akea, when it comes to tiles, “There’s something quite dreamy about a homeowners are gravitating towards low- freestanding bath with sculptural curves maintenance options that have high impact, like the Barcelona range from Victoria & as well as favouring larger formats (think Albert sitting proudly in a matt ȴnish. Vanity 300x600mm or 600x600mm, or even slab tops with a honed marble ȴnish, textural tiles). Matt, textural or low-shine ȴnishes matt Venetian plaster on walls, or tiles with are most popular with a feature tile, a handmade matt ȴnish are also increasing perhaps something patterned, of a di΍erent in popularity. Bathrooms have deȴnitely colour, or a bit glossier, used to make a moved away from the need to feel crisp, decorative statement. glossy and clean. Instead, we are leaning “For a ‘natural organics’ look, there might towards tactile layers that feel welcoming, be an all-over colour palette across ȵoor, wall interesting and relaxing.” and feature tiles using the same natural- “Matt solid-surface stone-resin baths and looking tile – or slightly contrasting shades basins, as well as concrete baths, basins between the walls and ȵoor,” she says. and vanity tops, are very on-trend and they “Interest can be added by using di΍erent tile are now coming out in a range of wonderful formats, such as a brick-bond or vertically earthy hues,” adds Kirsty. stacked subway tiles, Moroccan Zellige-style BATHROOM IDEAS 47
square tiles, or mosaics as a design feature. dynamic between the colours and gives the Matt tiles and surfaces are now being chosen space a biophilic feel.” by all but the most conservative or utilitarian To get the right mix of materials, Christie homeowners. For new builds we are seeing recommends creating a mood board. “This a trend towards sustainability, where the will help with visualising all your selections interiors are imagined with an organic in the space and conȴrm your choices in aesthetic across a materials’ palette that feature points or contrasts in your materials. leans towards the natural. The white-gloss This can help make sure that the natural and wall tile with polished chrome tapware seems soft ȴnishes are fulȴlling your original vision,” now largely reserved for the holiday home or she says. investment property, where it is a low-cost generic option.” To add a little shine to lift a muted “To complement warm metals and matt ȴnishes, consider incorporating a mix of task, ambient and accent lighting to highlight the materials palette, lightly polished engineered textures and tones in the space. Also infuse stone can be used for splashbacks and walls, the bathroom with personal touches, such as well as vanity tops, shower recesses, as unique accessories, artwork or plants to shelving and more. add character, warmth and individuality,” suggests Paul. CREATING A VIBE “Overall, matt-ȴnish or low-sheen tapware “There are two main e΍ects you can create can bring a sense of sophistication and style in your bathroom by using warmer metal to the bathroom, whether by creating contrast, ȴnishes,” says Christie. “Using softer-toned complementing tones, or contributing to a copper tapware, like our HAUS25 brushed minimalist look,” he continues. “To create a copper range, can create a more subdued, minimalist vibe, use matt-ȴnish tapware in blended look and a cosy, uplifting vibe when cooler, muted tones – perhaps brushed nickel used alongside the warmer tones of matt- and brushed stainless paired with a soft-grey ȴnish limestone tiles. Alternatively, you can or pale-blue palette. Matt-ȴnish bronze or create a high-contrasting vibe that has a bit gunmetal tapware, paired with a deep olive more energy by combining the earthy tones green or warm terracotta tile, can complement of copper tapware with soft blue or green earthy tones in the bathroom, creating a textured tiles. This creates an interesting calming atmosphere.” 48 COMPLETEHOME.COM.AU Above left Hints of gloss lift a palette featuring brushed metallics and earthy muted fi nishes. hansgrohe.com.au
FEATURE Left Soft natural tones work with the earthy tumbled travertine baton tiles. katelawrenceinteriors.com.au Bottom left Terzofoco countertop basins in Light Earth and matt black are design focal points. oliveri.com.au Bottom right Misha twin shower and wall mixer with a HAUS25 warm brushed copper fi nish. beaumont-tiles.com.au or accessories, creating a dynamic and balanced look.” Having a cohesive colour palette is essential. “You can achieve this by choosing a primary colour scheme and introducing natural hues and warm metals as accent elements rather than dominating the entire space,” advises Paul. “Introducing textural variety to add depth and interest is equally important. Use di΍erent materials, such as matt-ȴnish tiles, natural stone and HOW FAR DO YOU GO? timber ȴnishes to create a balanced, multi- For most who favour warm metal tones, dimensional space that feels inviting and natural colours and matt ȴnishes, it’s about thoughtfully designed.” achieving a balanced look. “It’s important But you can go all out. “Depending on to strike a balance to avoid going too far in the look you’re going for, I think an entire any one direction and create a harmonious, bathroom could successfully be made up visually appealing bathroom space,” advises of matt elements,” says Fiona. “The trick is Paul. “For balance, incorporate a mix of to really mix up the materials and textures matt and gloss ȴnishes. For example, if you and add contrast through colour. For have matt-ȴnish coloured tapware, consider example, you could opt for heavily textured pairing it with a sleek, glossy vanity top or tiles, a bath and basins with a subtle matt a polished metal mirror frame to create ȴ nish, and satin brass tapware and shower contrast and visual interest. ȴ ttings. Remember, there are elements in “Instead of sticking to just one type a bathroom that will naturally add some of metal, consider mixing metals in the gloss, like windows and mirrors, so don’t bathroom. This could involve incorporating be afraid of overdoing it with matt textures. both warm and cool metals, such as pairing Explore your creativity and have fun brass tapware with silver-toned hardware creating something unique!” BATHROOM IDEAS 49
50 COMPLETEHOME.COM.AU
FEATURE SHOWER SECRETS Shhh. Step a little closer. Want to know the most innovative, up-to-theminute goss on what’s new in all things showers? We’ve got the inside scoop on all you need to know to make your shower space a winner words carrol baker BATHROOM IDEAS 51
Above Cutting-edge technology is helping to make the once humble shower a divine therapeutic experience IN THE ZONE Open shower spaces are also very Modern showering spaces are designed popular. Amy Naylor, product marketing with comfort and luxury in mind. Perhaps lead from Reece, says they’re seeing a you love the day spa feel, a cool classic real trend towards opening up the Hamptons-inspired bathing space, or the shower enclosure and integrating it into organic feel of a Japanese-inspired space? the overall bathroom. “If you’re short on No matter what your style, when space, a wet room is a great way to include considering the layout of your bathroom in a shower and a bath if you’re not keen on relation to shower placement, Beaumont the more traditional shower-over-bath Tiles product specialist Michelle Kearney set-up,” she explains. suggests segmenting spaces into distinct When designing your shower, Amy adds areas. “It’s a good call to create designated it’s important to decide what you want your wet zones (showers and baths) and dry centrepiece to be – the bath, the shower or zones (vanities and toilet areas) so you the vanity? If it’s the vanity, there’s another don’t get wet feet every time you brush good reason to opt for a concealed shower. your teeth,” she says. This means the “We’ve seen a rise in installing the shower shower, towel railings and bathtub are behind a wall so you can feature the vanity separate from other elements of the room. as the centrepiece in the bathroom rather As well as a shower enclosure, you can have a walk-in shower, or have your than the shower if that’s your preference,” she says. shower positioned over the bathtub, a great option if you are short on space but enjoy a soak in the tub. You may also choose a concealed shower ON THE BENCH Luxury and comfort are becoming redeȴned in shower spaces with features such as that’s tucked behind other elements in a family seating. Adding seating or a shower bench bathroom or ensuite. It allows more privacy serves practical aspects, such as support and is a good choice for those who prefer a for those who need it. Amy says shower more streamlined and clutter-free room. benches are a great way to future-proof If you love the idea of a hidden shower your bathroom. “It’s important to build your space, Alana Perin, brand and showroom bathroom with the users in mind – you want manager at GT&B, says ȵ oor-to-ceiling tiled it to grow with you and the needs of your walls will enhance the luxurious ambience. family,” she notes. “Due to their concealed nature, you have an The shower bench can also be helpful opportunity to mix it up with the design,” when showering small children, and an she says, “including adding a pop of colour inbuilt or freestanding shower seat also or pattern that contrasts with the other o΍ers extra storage, as well as somewhere elements in the bathroom to create a to relax and infuse a spa-like experience surprise as you step inside.” into your showering routine. 52 COMPLETEHOME.COM.AU
FEATURE Above A dual shower is perfect for busy couples or families on the go Builder build2grow Image BWRM Bellarine A TOUCH OF ORGANIC be ȵ uted or frosted glass for a more design- Curved shower screens are a popular led approach to privacy. A great example of option for adding organic softness to a form meets function.” space. Many things in a bathroom are made up of hard robust surfaces; adding curves SHOWERS THAT SPARKLE can also become a feature – and it doesn’t There are several di΍erent options for your have to stop there. A curved shower wall shower screen, including glass you can see is a fabulous way to add a splash of luxury; right through, and one that has a ȵuted a gentle curve or something even more e΍ect that adds privacy, while still allowing deȴned can bolster privacy too. light to pass through. There are also curved mirrors and Deanne Crowther, interior designer from vanities. “We’ve seen a rise in more organic, Oldham Services, says you can also use soft edges across the entire bathroom,” ȵuted glass on the door to a separate WC. “If shares Amy. “People are also experimenting you have a large bathroom with a cubicle, a more with their glass design, whether that door is thicker. A piece of glass is only 10mL, BATHROOM IDEAS 53
Curves, metals, and a cut-glass vanity combine to create a memorable impression 54 COMPLETEHOME.COM.AU
FEATURE Above A beautiful bathroom that is all about luxury Right A stylish black and white contrast in an open shower space so it can be ȴ tted to o΍er privacy without encroaching on the space,” she comments. In showers, Deanne advocates using ultra-clear glass. “I have it coated and to clean it, you just squeegee the glass; the soap scum never gets into the shower screen,” she says. “There is also no green tinge that you can ȴnd in clear glass.” If you are opting for ȵ uted glass, you can also complement this e΍ ect with beautiful delicate ribbed surfaces on vanity units and cabinets. WATER WORKS Looking for the best shower to suit your needs? Alana from GT&B says step one to selecting the best shower for you is understanding who will be using it. “For example, a rail shower is the perfect solution for a family bathroom,” she suggests. “The sliding rail allows for versatility and can be adjusted to any height to suit each person.” BATHROOM IDEAS 55
Above A biophilic bathroom connects to nature – added curves bring organic appeal A rail shower is also easy to clean, At Pheonix Tapware, LuxeXP™ is the saving you time and energy. Alana says in latest development in shower spray the master ensuite, you can add a ceiling- technology. Chantelle Malone, marketing dropper and hand shower combination manager at Phoenix, says the patented for the ultimate in luxury. “On the days you technology used to create the LuxeXP™ don’t want to wash your hair, or need to spray pattern is called a pressure swirl wash your tan o΍, the hand shower will be atomiser. “These atomisers utilise the your best friend,” she shares. “Make sure to energy from the high-pressure water ȵ ow install two separate wall mixers so you can to induce a swirling motion, generating use both the ceiling and hand shower at the centrifugal forces that cause the water same time.” to exit the low-proȴle nozzles in almondshaped sheets,” she explains. “These then INNOVATIONS IN TAPWARE break down into a multitude of water What sort of showering experience are you droplets, enveloping the shower user looking for? A shower can invigorate, it’s a in a soothing cascade, delivering a truly way to refresh and begin your day, it can immersive shower experience.” also be therapeutic, a relaxing experience to help you unwind. Fabulous new tapware is taking centre 56 COMPLETEHOME.COM.AU The thermostatic mixer is another innovative bathroom product. It’s all about personalising your shower experience – stage in shower spaces, giving you more setting the temperature to your comfort control over your showering experience. level. At Reece, Amy says they think it’s an Jeanette Aston, head of marketing at Greens innovative idea. “We’ve all been a victim of a Tapware, says their Rainboost technology cold shock when someone else in the house creates large droplets of water to help you ȵushes a toilet or turns on the kitchen tap,” relax and unwind. “Or our Airȵow tech she says. “Enter thermostatic mixers, a great delivers a powerful and invigorating spray to innovation that controls the water ȵow and refresh tired bodies,” she adds. temperature at the press of a button so you
FEATURE Above The Textura twin rail shower makes showering a relaxing experience Right A private shower space and wall niche for storage with a neutral palette has plenty of style won’t get those unexpected ȵuctuations to interrupt your routine.” THE ZEN SHOWER A relaxing shower is the perfect antidote to a stressful day. Why not take it one step further by creating a shower space that is all about relaxation and calm? Michelle says it all begins with letting natural light in through a skylight or a highlight window. “This lighting will be enhanced by choosing a lighter tile, like the Beaumont Max Monza Light Beige tile, to bring brightness to the space and create a beautiful connection with nature. You’ll be able to enjoy sunrises or the awesome pink clouds at sunset,” she says. From ceramic, porcelain, glass, marble and more, there’s a diverse array of options to tile your shower. Raw and organic BATHROOM IDEAS 57
58 COMPLETEHOME.COM.AU
FEATURE Opposite top Light-fi lled and welcoming, a wellness bathroom in neutrals serves to soothe Opposite bottom A feature wall in calming hues, and a pop of colour with a beautiful window make this bathroom shine Right A tropical bathroom design and a black diamond towel rack are a fusion of luxe and an island getaway experience ȴQLVKHVLQWLOHVFDQWDNH\RXUVKRZHU VSDFHWRWKHQH[WOHYHO7LOHVKDSHVFDQ LQFOXGHKHUULQJERQHNLWNDWVXEZD\DQG PRVDLFVVPDOOIRUPDWVTXDUHRUODUJHWLOHV GHSHQGLQJRQ\RXUSUHIHUUHGORRNΖQWLOH FRORXUVQHXWUDOVDUHGHȴQLWHO\VWLOORQWUHQG EXWVRPHDUHRSWLQJIRUVSODVKHVRIFRORXU LQVSLUHGE\QDWXUH%OXHVJUHHQVDQGSDVWHO KXHVDUHPDNLQJDVWDWHPHQWWRR &RPSOHPHQWWKHORRNZLWKWDSZDUH WRVXLW)RUWKHȴQDOWRXFKHVDGGVRPH OX[XULRXVEDWKSURGXFWVLQWKHVKRZHU VSDFH7KLQNWKLFNȵX΍\WRZHOVDKHDWHG WRZHOUDLOVFHQWHGFDQGOHVDQGOHDI\SRWWHG SODQWVWRLQYLWHLQQDWXUH MATERIALS TO INSPIRE 0HWDOVDUHGHȴQLWHO\PDNLQJWKHLUPDUNLQ EDWKURRPWDSZDUH$W*UHHQV7DSZDUH -HDQHWWHVD\VLWȇVDOODERXWDGGLQJEHDXW\LQ GHVLJQDQGFRORXUDVZHOODVWH[WXUHWRWKH VSDFHȊ%UXVKHGEUDVVEUXVKHGFRSSHUDQG /LQHDUGUDLQVDUHPRGHUQDQGVOHHNDQG OHVVZDWHUDQGHQHUJ\ZLWKRXWUHGXFLQJȵRZ EUXVKHGQLFNHODUHFRPLQJWKURXJKLQRXU UXQDFURVVWKHȵRRU7KH\ȇUHHDV\WRFOHDQ UDWHDWWKHVKRZHUKHDG7KHLUVKRZHUVEHJLQ ȴQLVKHVZLWKFRQVLVWHQWPDWFKLQJDFURVVRXU DQGSHUIHFWIRUGRXEOHVKRZHUV ZLWKWKUHHOLWUHVRIGULQNLQJZDWHUZKLFKLV VKRZHUVDQGDFFHVVRULHVȋVKHVD\V $WLOHLQVHUWGUDLQLVDW\SHRIOLQHDUGUDLQ WKHQȴOWHUHGDQGKHDWHGDQGSDVWHXULVHG ΖWEOHQGVLQWRWKHȵRRULQJDVLWLVWLOHGOLNH ZKLOHLWȇVLQXVH1RZDWHULVVWRUHGLQWKH EUXVKHGQLFNHOȊ&RORXULVWKHKHURLQ WKHUHVWRIWKHVKRZHUȵRRUVRORRNVVOHHN VKRZHURUVKDUHGEHWZHHQXVHUV DQGEH\RQG2XUFXVWRPHUVORYH DQGVRSKLVWLFDWHG5RXQGRUVPDOOVTXDUH EUXVKHGQLFNHOWDSZDUHȋVKHQRWHVȊ6RIW GUDLQVFDQVWLOOEHXVHGWKHVHKDYHOLPLWHG LQFOXGHVJUH\ZDWHU IURPVKRZHUVEDVLQV \HWVRSKLVWLFDWHGLWFDQWDNHRQERWKZDUP ZDWHUFDSDFLW\WRGUDLQFRPSDUHGZLWK DQGZDVKLQJPDFKLQHV DQGEODFNZDWHU DQGFRROXQGHUWRQHVPDNLQJLWDJUHDWȴQLVK OLQHDUGUDLQV IURPWRLOHWVGLVKZDVKHUVDQGNLWFKHQVLQNV  SHOWER WATER RECYCLING UHF\FOHGDQGXVHGWRZDWHU\RXUSODQWV $W*7 %$ODQDVD\VWKHIRFXVLVRQ *UH\ZDWHUIURP\RXUVKRZHUFDQEH WRZRUNDFURVVPXOWLSOHFRORXUSDOHWWHVDQG GHVLJQVW\OHVȋ :DVWHZDWHUSURGXFHGE\DKRXVHKROG SYSTEMS +RZPXFKVKRZHUZDWHUGR\RXZDVWH DOWN THE DRAIN 7KHVHGD\VHFRFRQVFLRXVQHVVLVIURQW ZDLWLQJIRUWKHVKRZHUWRUHDFKWKHULJKW 6KRZHUGUDLQDJHLVLPSRUWDQWWRR7KHUH RIPLQGIRUPDQ\:LWKȴQLWHUHVRXUFHVLW WHPSHUDWXUH"<RXFDQSRSDEXFNHWLQ DUHVHYHUDOPDMRUVW\OHVXVHGHDFKZLWK PDNHVVHQVHWRVDYHZDWHU&RPSDQLHVOLNH WKHVKRZHUDQGKDUYHVWWKDWZDWHUIRU LWVEHQHȴWV &LQWHSR΍HUVKRZHUVWKDWXVHSHUFHQW \RXUJDUGHQ BATHROOM IDEAS 59
L E AD I NG T HE W A Y Transforming bathroom design with Solid Surface For over 30 years, Australian brand Omvivo has led the OMVIVO SOLID SURFACE charge in contemporary bathroom product design, setting Omvivo Solid Surface™ o΍ ers unparallel design the benchmark for innovation and quality in the industry. ȵ exibility, allowing for the creation of product with With a commitment to excellence, Omvivo continues to distinctly unique features such as smoother curves, push boundaries and redeȴne the bathroom environment. sharper edges, reȴ ned details and seamless joins. In In its infancy, Omvivo was one of the very ȴrst design addition, the smooth matte ȴ nish of Omvivo Solid manufacturers to adopt, recognise and master solid Surface™ seamlessly complements contemporary surface fabrication in the bathroom environment. interiors, embodying the essence of modern luxury. Omvivo has since become a leader in the industry. For Omvivo Solid Surface™ is non-porous, durable, easy Omvivo, solid surface is more than just a material, it’s to clean, hygienic, repairable, non-toxic and safe, o΍ering the cornerstone of design — the canvas and the muse a superior and sophisticated product for bathroom if you will! environments and the home. 60 COMPLETEHOME.COM.AU
SPONSORED CONTENT SAFETY FIRST At Omvivo, safety has always been paramount. Omvivo’s solid surface material has continuously created a safe, non-toxic product ideal for residential and commercial environments. Unlike engineered stone or quartz stone, which has been banned in Australia as of July 2024 due to health issues caused by exposure to crystalline silica dust, Omvivo Solid Surface™ does not contain harmful silica. This not only ensures the safety of our employees during manufacturing, it also provides clients peace of mind, knowing they are choosing a safer and healthier option for their homes. omvivo.com Suzie Dyson, Omvivo’s General Manager, highlights the signiȴcance of this safety aspect, stating, “Health and safety is of utmost importance to us at Omvivo. Our products do not contain harmful silica, and we are proud to o΍er a beautifully designed, superior product that is manufactured with the wellbeing of our employees and clients at front of mind.” HYGIENIC EXCELLENCE In addition to the safety beneȴts, Omvivo Solid Surface™ is exceptionally hygienic. Its non-porous surface and formula provides anti-bacterial qualities, while the seamless design eliminates areas where dirt and germs can accumulate, at the same time making it easier to maintain and clean the products. THE FUTURE OF BATHROOM DESIGN As the demand for beautiful, contemporary bathroom products for renovations and new homes continues to grow, the Omvivo bathroom collection remains at the forefront of the market. Beyond its safety and hygiene advantages, solid surface products open a world of design possibilities. Providing a hygienic and sustainable solution of superior design and quality, Omvivo is an obvious choice for designers, builders and homeowners alike. In addition to the signature Omvivo bathroom collection, Omvivo o΍ers a stunning Australian-made range as well as custom design solutions. Its versatility allows for the creation of intricate shapes and seamless transitions, allowing designers to bring their visions to life with precision and creativity. Solid surface provides the ȵexibility needed to realize even the most ambitious design concepts. With Omvivo Solid Surface™, the only limit is your imagination. BATHROOM IDEAS 61
This is your go-to guide for blending heritage features and modern elements to create a statement in your bathroom design 62 COMPLETEHOME.COM.AU
FEATURE NOSTALGIC LUXURY words karsha green one are the days when bathroom design was just about sewerage pipes and plumbing. From rudimentary holes in the ground, bathrooms evolved into utilitarian spaces with only the functional necessities for you to do your business and leave. Today, however, bathrooms are sanctuaries of style and comfort within our homes, retreats from the chaos of our daily lives where we can indulge in a touch of selfcare and relaxation. Bathrooms are spaces to incorporate personality and luxury. In modern homes, while comfort and aesthetics remain important in our design choices, we have a growing consciousness about the materials we use and our impact on the environment. Restoring heritage features and incorporating sustainable materials doesn’t mean you have to sacriȴce the “wow” factor. By seamlessly Interior design project, Mez Haus by Bone and Blanc. Image The Palm Co. boneandblanc.com.au blending old-world charm with modern aesthetics and innovation, you can infuse your bathroom with utmost depth, character and sophistication. BATHROOM IDEAS 63
BALANCING HERITAGE WITH MODERNITY Below Bombora Custom Furniture used recycled Australian wood from the local Victorian eucalyptus species of messmate, wormy chestnut and Australian chestnut. This custom messmate bathroom vanity has so much character and gives warmth and personality to this modern bathroom design. bomboracustomfurniture.com.au Above The Mez Haus Project designed by Bone and Blanc beautifully captures the elegance of this cottage and the featured stained-glass window. Keeping the tonal palette natural and light, Court and Riss has created a modern bathroom that pays homage to its history. boneandblanc.com.au Image The Palm Co When aiming to create a harmonious balance between heritage charm and modern aesthetics in your bathroom design, consider the following: VINTAGE ELEGANCE WITH HERITAGE FIXTURES PAY HOMAGE TO ARCHITECTURAL HISTORY To infuse your bathroom with old-world Preserving and restoring architectural details charm, incorporating ȴ xtures such as is a beautiful way to honour the history of a clawfoot bathtubs, pedestal sinks and space. Exposed brick walls, original hardwood ornate faucets is a good place to start. ȵoors, and intricate mouldings can become These timeless pieces not only evoke focal points of your bathroom design, nostalgia, they also add a sense of luxury to showcasing its history rather than hiding it. a space. Consider pairing them with modern By resurfacing hardwoods or repainting brick amenities like sleek stone countertops or walls in a modern colour, you can create a a monochrome colour palette to create a timeless and relevant space. captivating aesthetic of old and new. 64 COMPLETEHOME.COM.AU
FEATURE Above Hyperion Tiles is a UK-based company that is recycling terracotta pavers and relaying them in a herringbone pattern to create a timeless look and feel in this bathroom. hyperiontiles.co.uk Left Faucet Strommen faucets come in beautiful antiquebrass fi nishes that exude an elegant old-world charm. This is the Pegasi wall mixer in antique brass. faucetstrommen.com.au Above This bathroom design is full of old-world charm, but adding in a fun and colourful bath mat like the Sunset Floral Pink mat from Bonnie and Neil brings vibrancy and character to this space. bonnieandneil.com.au REINVIGORATE RECLAIMED MATERIALS PERSONALISE WITH MODERN ACCESSORIES Reclaimed materials can bring so much character to a space. Whether it’s reclaimed timber vanities, herringbone tiles, antique mirrors or brass pendants, these elements can be statement pieces in their own right. Pair them with bold accent colours, clean modern lines and stone textures to create an elegant sanctuary that oozes luxury and relaxation. Simply bringing in contemporary art and accessories, bold textiles and statement lighting into a heritage-inspired bathroom can quickly reinvigorate a space. These modern touches not only add colour and ȵair, they can also be a great way to infuse your personal style. By carefully selecting art and decor that complement your bathroom’s heritage features, you can create a room that feels uniquely yours while still paying homage to its history. Achieving timeless elegance is a ȴne balance between honouring heritage features and embracing modern design sensibilities. By thoughtfully integrating heritage ȴ xtures, preserving architectural details, incorporating reclaimed materials, and adding your personality with modern colour and decor, you can create a bathroom that brings together the best of both worlds. The result is a space that feels classic yet fresh and inviting, and ready for another century. BATHROOM IDEAS 65
RECLAIMED, REVIVED & RA V IS HIN G Home enthusiast, designer, decorator and blogger, Kristine Franklin, discusses ways to incorporate repurposed and upcycled furniture and materials into your bathroom words kristine franklin, interior designer, the painted hive interiors T here’s no better way to inject a timeless sense of uniqueness into a bathroom than through the use of reclaimed, repurposed or upcycled items. When done right, their inclusion o΍ers a level of tailored charm you simply can’t replicate with brand new alternatives. Far from being a merely cheap or “make-do” solution, including pre-loved elements is often a very deliberate one, intended to beautifully bridge a gap between luxury and sustainable design – a movement gaining traction as we all become more aware of our impact on the earth. A bonus is the fact that second-hand goods may often be obtained inexpensively, however there are also quite scarce and more sought-after items that attract a premium price. Being rather “ȴ xed” in nature, spaces such as bathrooms require special consideration during the planning and design phase to allow for the integration of upcycled items from the get-go. This Clawfoot bath tubs, whether new or restored, exude a luxurious heritage aesthetic. Image Emily Powers, Unsplash Incorporating heritage features such as a gold towel radiator, stained glass and herringbone tiling is a beautiful way to bring timeless charm into a modern setting. Image Super Snapper, Unsplash 66 COMPLETEHOME.COM.AU
FEATURE AFTER Above & top Instead of retiling an older bathroom, give it a fresh, modern look while still retaining its charm with Dulux Renovation Range Tiles and Benchtops. dulux.com.au BEFORE means ensuring any embedded elements such as tiles, vanities, tapware, tubs and basins are sourced and speciȴed in advance. To ȴnd potential items, check out reclamation yards, salvage warehouses and online platforms such as Facebook Marketplace. And don’t forget to think outside the box; just because an item wasn’t originally intended for bathroom use doesn’t mean it can’t be repurposed. A mid-century sideboard may be overlaid with stone to form a one-of-a-kind vanity. Salvaged ȵagstone ȵoor tiles can become a shower stall feature wall. Perhaps, more ambitiously, something like a primitive farmhouse feed trough or antique laundry soaking tub can make for an amazing statement piece in a modern bathroom. The key when incorporating quite rustic items is to balance them with a simple and clean overall aesthetic, or elevate them with the inclusion of more contemporary and sophisticated elements. If you’re looking to impart reclaimed charm into an existing bathroom, there are plenty of ways to add upcycled items. Textiles, like Persian ȵoor rugs or vintage fabric used as shower or window curtains, can have a huge impact. Not only do textiles work to soften what is traditionally a very “hard” surfaced space, they can introduce colour, pattern and texture. BATHROOM IDEAS 67
68 COMPLETEHOME.COM.AU
FEATURE Opposite page From the gold accents to the vintage-style mirror and heritage mouldings, paired with the pastel green and bright floral wallpaper, this bathroom is a beautiful combination of old and new. Image Grace Kelly, Unsplash Above Whether working with a reclaimed timber vanity or not, adding antique cabinet knobs can completely transform your bathroom design. Image Taylor Beach, Unsplash Reclaimed timber can look modern, like this reclaimed timber vanity by Bombara Custom Furniture. Image Kristian van der Beek. bomboracustomfurniture.com.au This ultra-modern bathroom is softened and given a new personality with a Persian rug and some foliage. Image Good Days Digital, Unsplash Likewise, vintage wall art or heritage wallpaper can work to elevate a bathroom. Another aspect which can have a distinct inȵuence is lighting. Whether it’s a bold statement pendant or a pair of delicate wall sconces, you can look to incorporate second-hand pieces to provide a unique edge. The same can be said about hardware. Switching generic cabinet knobs or pulls with something antique or vintage can be completely transformative, as can the introduction of reclaimed towel hooks or bars and so on. And never forget about the power of general furniture and decor. Where space allows, free-standing furniture such as cabinets, shelves or stools can o΍er character infused with function, and decor always works to bolster personality. Being central in the design for many bathrooms, mirrors also provide a perfect avenue to incorporate something pre-loved. There are endless beautiful old mirrors which will give your bathroom an instant boost, but even a basic mirror can be easily upcycled with a lick of paint to provide a bespoke feel. The options are almost endless and only limited by your imagination! Want to know more from Kristine? Visit her blog thepaintedhive.net BATHROOM IDEAS 69
HOW TO WOW Here’s a selection of curated products that will add a statement to your bathroom design with a touch of nostalgic luxury and a thought for environmental consciousness 01 Textiles are such a fun way to add colour and personality to a space, and it’s no di΍erent in the bathroom. The Wave bath mat by Bonnie and Neil is playful, bright, and a gorgeous addition to any design style. bonnieandneil.com.au 02 Natural stone is a beautiful, sustainable resource and a great addition to a bathroom space. This is the Natural River Stone bathroom basin from Bali Abundance, individually handmade from Balinese river stone. baliabundance.com.au 03 Faucet Strommen products are made almost entirely out of the inȴnitely recyclable material known as brass. A gorgeous, heritage-inspired product that also considers its environmental impact … winner! faucetstrommen.com.au 04 Handmade, 100 per cent cotton, the extra-large Deco bath runner by Ohh Happy Home is made using non-toxic dyes, natural ȴbres and is also 100 per cent biodegradable. ohhappyhome.com.au 05 A stunning way to modernise a heritage bathroom is by adding a statement wallpaper. The Flying Japanese Cranes mural wallpaper in Tancho Pink is made by Hovia using eco-friendly materials. The crane is a symbol of happiness and the graceful beauty of the crane will give your space an inviting and relaxed feel. hovia.com/au 06 The Acquamiki pendant by Product Privata, available at Mondoluce, is made of blown and painted metal. Its curved lines are feminine and reminiscent of vintage wall lamps. mondoluce.com 07 The Jungle Symphony wallpaper in lavender, designed by Iryna Ruggeri for Milton & King, o΍ers an enchanting and 70 COMPLETEHOME.COM.AU 01 02 03 04 05
FEATURE 08 06 melodious pattern in a soothing green and purple colour palette. Milton & King wallpapers are made using the latest ecofriendly printing tech, meaning no overproduction waste. They are PVC-free, use odourless water-based ink and are 100 per cent vinyl-free. miltonandking.com/au 08 Court and Riss from Bone and Blanc interiors used terracotta pavers in the Mez Haus bathroom design and we love it! While the pavers have a rustic aesthetic, the clean lines and light colour palette of the bathroom keeps the space feeling bright and modern. Paired with American oak vanity, concrete basins and copper tapware, this bathroom is a beautiful representation of blending old and new. Image The Palm Co. boneandblanc.com.au 09 Would an illuminated metal sculpture of a face on your bathroom wall create enough of a statement for you? The Visio wall lamp by Masiero, available from Mondoluce, is luminous architecture and would make an incredible statement in a bathroom design. mondoluce.com 10 The Ilium by Nemo, available at Mondoluce, is a pendant lamp with di΍ used light output. It will provide a soothing illumination for a luxurious bathroom design. And the curved indentations of the cylinder barrel glass have a timeless charm. mondoluce.com 11 Five Mile Radius is creating Australia’s only concrete surface made entirely from concrete waste. The made-to-order Waste Terrazzo slab combines excess wet concrete with crushed demolition waste to create a statement bathroom piece full of character. ȴvemileradius.org 12 Bombora Custom Furniture used recycled Australian wood from the local Victorian eucalyptus species of messmate, wormy chestnut and Australian chestnut. This custom bathroom vanity and vintage teal tiling give the space warmth and character while still remaining timeless. bomboracustomfurniture.com.au 07 10 09 11 12 BATHROOM IDEAS 71
EXPERT ADVICE Designing a new bathroom can be an overwhelming experience. You’ll need to make many decisions between budgeting and building, and careful planning is essential. The Kitchen & Bathroom Designers Institute (KBDi) has written the rule book on bathroom design. words selina zwolsman, KBDi Below you’ll find KBDi’s five top tips for creating a beautiful bathroom space. 1. BE REAL WITH YOUR BUDGET 2. CREATE A LIVEABLE LAYOUT 3. PRIORITISE VENTILATION AND LIGHTING While the space is often small, the costs can be high in a new bathroom build. Budgets typically range between $10,000 and $40,000 (the average renovation costs around $26,000), and there are many variables to consider. With the room being a wet area (ie. there’s water splashing around), you won’t want to compromise on waterprooȴng or ȴ t-for-purpose materials. And if your bathroom will be used every day – likely for a very long time – you’ll want to invest in highquality ȴ xtures and ȴ ttings. Real estate experts say an aesthetically on-point bathroom can add thousands of dollars in value, so ensuring your bathroom is visually impressive is important too. A skilled designer and reputable bathroom builder will help you be real with your budget without compromising where it matters most. In 2022, the National Construction Code (NCC) introduced new requirements related to “liveable housing”. The new rules apply to both houses, townhouses and individual apartments, and following a transition period, were ultimately adopted in most States and Territories in October 2023. The revisions implement features based on the Liveable Housing Design Guidelines silver standard. The changes ensure that housing is designed to meet the needs of the community, including older people and those with mobility limitations. In short, a Eɝcient ventilation and thoughtful lighting are crucial for creating a comfortable and functional bathroom environment. Install a quality ventilation system (externally ducted exhaust fan) and openable windows to control humidity levels and prevent mould and mildew growth. When lighting your space, incorporate a combination of ambient, task and accent lighting to enhance visibility and create a welcoming atmosphere. Interior designers and lighting design experts will show you how to successfully layer all three types of light. They’ll also know about the Australian Standard applicable to lighting and power in bathrooms and help you make the right (compliant) decision. 72 COMPLETEHOME.COM.AU liveable bathroom design will allow for: x Ease of movement within the home (ie. through internal doors and corridors) x Ease of movement using a toilet x Ease of access to and movement within a shower x The ability to add supports like grab rails (through the reinforcement of bathroom and toilet walls) Ask your designer about how you can make your bathroom liveable for you and your family now and in the future. Opposite page The careful selection of Venetian plaster and large-format tiles make this Birdblack Design bathroom exceptionally easy to clean.
D ES IGN I NG A BATHROOM? ASK THE EXPERTS BATHROOM IDEAS 73
SHOWCASE D ES IGN ING A BATHROOM? ASK THE EXPERTS 01 4. SEEK OUT SUITABLE STORAGE SOLUTIONS Well-considered storage solutions will help you keep your bathroom organised and clutter-free. Assess your storage needs for toiletries, towels, cleaning supplies and other bathroom essentials and consider the functional storage philosophy. Functional storage is centred around: 1. Storage at the ȴrst or last place of use (eg. a towel must be easily accessible from the shower or bath). 2. Visibility of supplies (eg. storing toiletries one row deep on narrow shelving allows all items to be easily identiȴed). 3. Ease of accessibility to items (eg. frequently accessed items should be stored within easy reach between eye level and hip level). A skilled designer will consider the speciȴc storage needs of your bathroom and develop functional solutions for you and your family. 5. FIND FIT-FORPURPOSE FINISHES Bathrooms are classiȴed as “wet areas” for obvious reasons, and it’s critical that you select materials and ȴnishes that will hold up to the potential exposure to water, steam and condensation. Wet tiles can be slippery, so ȴnd a ȵoor tile with a certain level of slip resistance. Keep in mind that ultra-grippy tiles can create problems, too, and cause all kinds of cleaning headaches. A magniȴcent mosaic may win your heart in the tile shop, but a poor application (ie. shonky tiling) or excessive amount of grout in a hard-toclean area could cause you grief. Matt black tapware may be high on your wish list, but cheap and nasty knocko΍ s will cost you more money down the track. A bathroom design professional can o΍er invaluable guidance in selecting suitable materials and ȴnishes. Your investment in their advice will yield the best return and a beautiful bathroom. 74 COMPLETEHOME.COM.AU FIVE O F O UR FAVOURITE BATHROOMS Kitchen Capital KBDI WA BATHROOM DESIGNER OF THE YEAR 2023 1 Designer Caitlin McNeill of Kitchen Capital was charged with creating an easy-to-clean bathroom for her clients, and she delivered. With clever space planning, Caitlin created a screen-free walk-in shower zone with large-format tiles and minimal grout lines. An in-shower shelf is the perfect place for toiletries, and a newly installed window brings natural light into the space. A large double vanity provides ample storage space in easily accessible drawers, and mirrored cabinets above tick the boxes for functional, eye-level storage.
EXPERT ADVICE 02 AM Interior Studio KBDI QUEENSLAND BATHROOM DESIGNER OF THE YEAR 2023 03 2 This stunning master suite earned Queensland designer Ashley Maddison the state title of KBDi Qld Bathroom Designer of the Year in 2023. The ensuite was designed and detailed to an extraordinary level and is certainly made for two. Dual showers and vanities are symmetrically placed to perfection, and the storage solutions are outstanding. The designer has used the functional storage philosophy to allow for all kinds of access. From the in-shower niche to the ample drawers and cabinets to the dedicated make-up zone and fully decked-out robe, this master suite is an excellent example of a well-planned bathroom design. GIA Renovations KBDI VICTORIAN BATHROOM DESIGNER OF THE YEAR 2023 3 Natural light bathes this beautiful bathroom designed by Carmel Wylie of GIA Renovations. The 1.6m-diameter window is the superstar of the space and was central to all the design decisions. The new window brings abundant natural light to the previously dark and gloomy space and opens up an always-changing view. The designer cleverly replicated the shape throughout the bathroom, with an impressive circular mirror backlit with LED lighting, disk-shaped wall lights, and round tapware and robe hooks. With large-format floor tiles and Venetian plastered walls, grout is limited and cleaning is a breeze. BATHROOM IDEAS 75
EXPERT ADVICE 04 05 Birdblack Design KBDI AUSTRALIAN BATHROOM DESIGNER OF THE YEAR 2023 4 This project was a hands-down bathroom favourite for the 2023 KBDi Design Awards judging panel. The organic curves implemented throughout the space eliminate hard edges and hip bruises, making it a safe and comfortable space for the empty-nester clients. The careful selection of finishes makes the bathroom easy to clean, too. A solid surface ledge wraps around the space, gently rolling into a stylish, seamless vanity top with an integrated basin. The walls are fi nished with Venetian plaster, and large-format tiles on the floor mean grout is at an absolute minimum. A combination of wall lights, recessed LED strip lighting and downlights allow the bathroom to be dimly lit for a moody vibe, or be bright and clear when required. Britt White Studio KBDI VICTORIAN HIGHLY COMMENDED BATHROOM DESIGNER OF THE YEAR 2023 5 This chalet bathroom was built on a budget, but no corners were cut on character and charm. Designer Britt Howard cleverly selected long-lasting fi nishes that complement the building’s heritage and will stand the test of time. Terrazzo-look porcelain tiles offer a practical and hardwearing floor fi nish, while glossy green wall tiles help to bounce light around the relatively small space. Storage is proportionate to the overall size of the room and easily accessible to the holidaymakers. The bathroom is as practical as it is pretty. 76 COMPLETEHOME.COM.AU
FIND A DESIGNER NEAR YOU AT kbdi.org.au Bathroom designed by KBDi Australian Bathroom Designer of the Year 2023 Birdblack Design DREAMING OF A BLISSFUL BATHROOM? A BATHROOM BUILD CAN BE A BUMPY RIDE. A DESIGN PROFESSIONAL WILL SMOOTH THE WAY TO A HAPPY ENDING WITH A BEAUTIFUL, FUNCTIONAL, SAFE BATHROOM. Your ideal bathroom may be very different from your neighbour’s. To some, it’s the ultimate retreat – a place to seek solace and soak away the worries of the day. To others, it’s more like Central Station – churning out the family one by one as each prepares for the day ahead. Some prefer the bathroom to be minimalistic; others seek solutions to a storage crisis and have cupboard space high on their list of priorities. A welldesigned bathroom will be easy to clean and a safe place to be. The best bathroom design professionals will: • assess your family’s requirements – no point in having a stunning bathroom if it doesn’t meet your household needs • pay great attention to waterproofing, drainage, falls to floor wastes, etc., and have an excellent understanding of the relevant Building and Plumbing Codes • advise on the suitability and availability of products, such as tiles, stone, laminate and glass. Many materials can be worked into a successful bathroom design, but they must be practical in their application. Engaging a Design Professional When investing in the services of a professional designer, you should feel confident that the person designing your new bathroom: When you choose to work with a KBDi Member, you can rest assured your designer is part of a forward-thinking, industry-focused design community and is well and truly ready to go! • is well aware of the innovative hardware available on the market and will advise on systems most appropriate – for you and your budget • is knowledgeable about the practicalities (or otherwise) of surfaces and materials and • shows evidence of continuing professional development. In an industry that is constantly evolving, a commitment to ongoing learning and product research is essential. Building Codes and contractual requirements change, appliances and materials are continually being developed. Trends come and go – you need to be confident that your designer is committed to their career, engaged with the industry and in the know. KBDi Members are committed to their profession, and know all the right questions to ask to get you the kitchen of your dreams. Learn more about our nation-wide membership at kbdi.org.au.
BATHROOM SHOWCASE

80 COMPLETEHOME.COM.AU
PROJECT E ART HY WON D ER design holman designs & mel wilson interiors build vand builders This home’s exterior is clad in strong layers of hardwood timber, and the interior heavily features natural earthy tones. So the design team focused on bringing softness to the family bathroom through curved lines, a round bath and a tonal, earthy colour palette. The tile selection from GT&B played a crucial role in bringing this vision to life. As you can see here, the Rosa Portogallo mosaics on and around the bath hob accentuate the warm terracotta tones of the bathroom and create a striking feature in the space. This is also the kids’ bathroom, and this tiled bath injects a healthy dose of fun to their nightly bath routine. BATHROOM IDEAS 81
PROJECT The tile selection from GT&B played a crucial role in bringing this vision to life On the other hand, the Amalȴ Za΍erano porcelain DESIGN RESPONSE tiles that appear on the walls and ȵoors were chosen to objective add to the room’s aesthetic while remaining easy to clean. To craft an earthy bathroom that matches the home’s colour palette and style The antique-brass light tapware adds to the organic, earthy feel of the space and will patina beautifully over time. The result is a gorgeous family bathroom that will no doubt age like ȴne wine. solution GT&B A unique round bath with Rosa Portogallo mosaics, and lowmaintenance Amalfi Zafferano porcelain tiles on the walls and floors g tandb.com.au A 5–17 West Fyans St, Newtown Vic P 03 5229 9111 E hello@gtandb.com.au F @gtandb I @gtandb_ 82 COMPLETEHOME.COM.AU
ECO ELEGANT MODERN BATH BACK TO WALL - LEFT & RIGHT HAND Size & layout options 9 size & layout options. Checkout our website for all options. All Eco baths have a non overflow option. Features & Benefits Tested to AS1172.5 Integrated overflow, with slot overflow hole. Mitsubishi sanitary grade acrylic sheet, crosslinking structure. Composite reinforcement layer with acrylic bonding resin. 18mm base board. Heavy duty galvanized steel frame. Adjustable feet for levelling. Back to wall and left hand right hand options to suit corner installations. SHOWER SCREENS BATHS Oceano Bathrooms 19A Kitchen Road Dandenong South VIC 3175 Tel (03) 9791 7782 Email sales@oceano.com.au oceano.com.au Composite reinforcement layer with acrylic bonding resin BATHS SHOWER BASES Checkout our complete range on our website Shower Screen • Baths • Shower Bases •
COASTAL CA LM build design rashi mathur (impala kitchens & bathrooms) build impala kitchens & bathrooms photography archetype photo The homeowners requested a complete bathroom overhaul when they ȴrst contacted Impala Kitchens & Bathrooms. The home originally had a separate toilet and bathroom, divided by a wall. Both rooms had no natural light and a dated colour scheme. The homeowners asked that the wall separating the two rooms be removed as part of the reno to open up the space. Although this was done skilfully, the newly created room was still quite long and narrow. Consequently, the team at Impala designed multiple layout options, each carefully considering the functionality of every inch of available ȵoorspace to ensure the homeowners got the most out of their renovation. After considering the numerous layouts, one that included a basin, shower, bath, toilet, and plenty of storage was chosen. 84 COMPLETEHOME.COM.AU
PROJECT BATHROOM IDEAS 85
PROJECT DESIGN RESPONSE objective To open up the existing bathroom and renovate it to reflect a modern, coastal-inspired style solution The team removed the wall dividing the bathroom and toilet to open up the space and selected fittings, fixtures, surfaces and hues that aligned with the homeowners’ request for a coastal feel As the home is fortunate enough to have coastal views, the design team selected the bathroom’s surfaces and colour palette with a coastal aesthetic in mind. The homeowners chose a large concrete-look tile for the ȵoors and wall – a perfect backdrop for the bath, basin and mirrors. The timber vanity exudes warmth, while the Superior White marble benchtop facilitates modern style beautifully. Together, the room’s colour palette, ȴ ttings and ȴ xtures succeed in creating a coastal ambience while adding an element of softness to the bathroom. IMPALA KITCHENS & BATHROOMS impalakitchens.com.au The design team selected the bathroom’s surfaces and colour palette with a coastal aesthetic in mind 86 COMPLETEHOME.COM.AU Drummoyne A 6/50 Victoria Rd, Drummoyne NSW P 02 9819 6915 Pennant Hills A 370 Pennant Hills Rd, Pennant Hills NSW P 02 9483 2222 Seven Hills A 5 Foundry Rd, Seven Hills NSW P 02 8824 2310 E sales@impalakitchens.com.au
PROJECT SPA L U X E design & build rosemount kitchens photography tim turner BATHROOM IDEAS 87
When the homeowners met with Rosemount Kitchens, they were very keen on renovating their apartment’s main bathroom, which had not had an upgrade since it was built. They were after a bathroom that would exude a spa-like feel, a luxurious sanctuary they could enjoy in the comfort of their own home. Of course, renovating rooms within a highrise apartment building is not without its unique challenges. Luckily, the team at Rosemount Kitchens are very experienced at completing challenging projects like this. They were able to work with the existing plumbing and ducting system, as well as the original footprint, to create a modern bathroom that meets the homeowners’ brief. 88 COMPLETEHOME.COM DESIGN RESPONSE objective To give the tired original apartment bathroom a modern, luxurious update worthy of a high-end spa solution The team used the existing plumbing, ducting and footprint to reimagine the room with the help of striking surfaces, premium fi xtures and considered mood lighting
PROJECT As you open the unique reeded glass sliding doors to enter the bathroom, you’ll be forgiven for forgetting you’re in an apartment home and not a high-end hotel. The homeowners chose the large-format terrazzo-look porcelain tile from San Marco Ceramics for the luxe appeal. The Brodware brushed Nordic brass ȴxtures juxtapose the tiles beautifully, while keeping with the luxe theme. LED strip lighting is featured in the bath niche and shower shelves, as well as under the glass mirror cabinets and as a wall sconce, creating mood lighting worthy of a hotel spa. The cabinetry, custom-made to brief by Rosemount Kitchens, gives the homeowners plenty of space to store their bathroom items, reducing clutter and helping maintain the room’s Zen feel. With a bathroom like this, there’s no need for expensive spa visits – the homeowners can enjoy a spa-like experience from the comfort of their home any time they choose. ROSEMOUNT KITCHENS rosemountkitchens.com.au A 2 Kingston Town Cl, Oakleigh Vic A 358 Whitehorse Rd, Nunawading Vic A 20 Napier St, Essendon Vic P 1300 476 736 F @rosemount.kitchens I @rosemount_kitchens BATHROOM IDEAS 89
S IM P LY A DRE AM 90 COMPLETEHOME.COM.AU
PROJECT Complete with high-end fixtures and GT&B’s Reverso Avorio Natural floor tiles, this bathroom is truly a dream come true design jeremiah locke DESIGN RESPONSE build murphy built objective Engaged to help a vibrant couple design their newly built To create a modern, earthy toned bathroom with pops of green home’s master ensuite, the designer knew that creating a space which reȵected their personality was key. The solution homeowners love colour and natural elements and The designer has used a clever combination of green features and earthy GT&B tiles to design a main ensuite that beautifully suits the home and the homeowners’ personalities requested a modern bathroom that suited their modern home… with plenty of green within. The idea to pair earthy tones and green features with travertine came to the designer in a dream, and it worked beautifully in reality. Emerald quartzite was chosen for the benchtop to match the kitchen, Dulux in Misty Moor Green was used for the vanity and wall, and GT&B’s exquisite Travertine Classico Stackbond Honed Mosaic tiles were selected to add contrast BATHROOM IDEAS 91
PROJECT while keeping with the room’s earthy aesthetic. The tile placement was a considered choice; the shower area is completely tiled to create a feature of sorts, and a simple strip of the travertine tiles wraps the rest of the room to connect it to the shower, creating perfect ȵow. Complete with high-end ȴ xtures and GT&B’s Reverso Avorio Natural ȵoor tiles, this bathroom is truly a dream come true. GT&B g tandb.com.au A 15–17 West Fyans St, Newtown Vic P 03 5229 9111 E hello@gtandb.com.au F @gtandb I @gtandb_ 92 COMPLETEHOME.COM.AU
COME AND VISIT US 162 Fulham Road, Alphington VIC 3078 CALL US (03) 9482 6054 We assist you to create your project. With a unique Italian flair.
F LUT E D & FA BULOU S design deanne crowther (bathrooms by oldham) build bathrooms by oldham 94 COMPLETEHOME.COM.AU
PROJECT BATHROOM IDEAS 95
The bathroom’s highlighted marble concave fluted wall adds depth, height and texture to the space Wanting a contemporary overhaul to their dated ensuite bathroom, the homeowners contacted Bathrooms by Oldham. Their wish list included a double shower, a bath, a vanity with plenty of storage, and a smart toilet. Though the bathroom you see here looks e΍ortlessly beautiful, navigating the renovation was complex at times. The plumbing in particular was challenging – the apartment is on the third ȵoor of the complex, and the homeowners did not want to disturb the apartment below to access the plumbing in their ceiling, so the design team had to plan the reno carefully around this. Ultimately, false walls were used, allowing the team to run the plumbing to where it needed to go and incorporate large niches. This facilitated the double walk-in shower, bath and smart toilet that are central to this bathroom’s timeless luxe aesthetic. The bathroom’s highlighted marble concave ȵuted wall adds depth, height and texture to the space, undoubtedly increasing its wow factor appeal. A sensory dimension has been created with soft strip lighting in niches, under the vanity and shaving cabinet, evoking a sense of tranquillity and reȴned elegance. BATHROOMS BY OLDHAM bathroomsbyoldham.com.au P E F I 96 COMPLETEHOME.COM.AU 0438 052 317 deanne@oldhamservices.com.au Bathrooms By Oldham @bathroomsbyoldham
bathroomsbyoldham.com.au Deanne Crowther (Sales & Interior Design) | 0438 052 317 | deanne@oldhamservices.com.au bathroomsbyoldham | Bathrooms By Oldham | Houzz - Bathrooms By Oldham
A ROBU ST RE T R E AT design robert bayly design build brilliant sa photography aaron citti Once a green-and-beige-tiled eyesore with a cramped shower and unused bath, this poorly lit and badly ventilated bathroom left the ’80s behind and was transformed into a contemporary oasis with room to move. With a brief calling for a masculine-style space, the bathroom was constructed sans bath, with a rather large shower taking centre stage. The client requested high-end quality and a neutral yet attractive aesthetic, replete with all the modern comforts. With this in mind, the team from Robert Bayly Design stepped up to create a bathroom that will provide long-term value. Large Dekton tiles were used to cover the ȵoor and walls, giving the space its modern, streamlined foundation. The room’s LED lighting array provides indirect and discreet illumination that bathes the space in a soft glow. A bespoke Duravit XViu freestanding 9 8 CCOOM MPPLLEETTEEHHOOM MEE. .CCOOM M. .AAUU
PROJECT BATHROOM IDEAS 99
vanity with bonded basin adds an elegant industrial element, while the Starck Sensowash toilet was a “must have” on the client’s comfort list. Rounding out the modern aesthetic is Gessi tapware and shower ȴ ttings in brushed satin. Adding a touch of warmth to the material palette is a tall storage cabinet crafted in solid timber by Jon Robinson. Encompassing some drawers, ȵat-panel doors and an open shelf, the richly hued joinery provides a warm richness alongside a healthy amount of storage. Inviting natural light into the room, a large rectangular picture window graces the shower, mirroring the frosted glass panel in the door leading to the hallway. Both bespoke and timeless, this sophisticated bathroom is all about comfort and quality. ROBERT BAYLY DESIGN P 0412 805 708 E rbdesignethics@gmail.com BRILLIANT SA brilliantsa.com.au A 219 Unley Road, Malvern, SA E hello@brilliantsa.com.au 100 COMPLETEHOME.COM.AU

PRODUCTS
PROFILES SHOWCASE
PRODUCT B E AU T I FU L B AS IN S 104 COMPLETEHOME.COM.AU
Left MONO Basin and Pedestal Above FAB Soft Square Basins Bottom right MOD 900 Choosing your bathroom’s new basin is among the most important decisions you’ll make when renovating. It needs to be functional, but its aesthetic can make a big impact on your bathroom’s overall ambience. Luckily, OMVIVO has many basin collections that nail both form and function. The MOD collection is the perfect solution for small spaces. Visually pleasing, the dynamic design with soft curves provides optimum function. Created with a premium solid surface, this compact collection features a generous integrated bowl and overȵow, and is easy to clean and maintain. The MONO collection includes classic-shaped basins with the option of a sculptural pedestal, or being ȴxed onto bathroom furniture. Clean and elegant, these basins are capable of adding a touch of luxe to any bathroom. If you want a unique basin, the FAB collection may be what you’re after. It allows you to create your own wall basin or vanity top. It will then be custom-made to your speciȴcation from OMVIVO’s sub undermount basin and solid surface ranges. OMVIVO produce a superior range of solid surface basins and baths for both commercial and residential projects. A homogeneous material, solid surface is resistant to stains, easy to clean and scratches or marks can be bu΍ed out. While the signature ȴnish is matt white, the Made collection is available in an extensive range of colours and ȴnishes. With 30 years of experience in designing and producing unique luxury bathroom products, OMVIVO is a brand you can trust. BATHROOM IDEAS 105
PRODUCT Above MOD 500 OMVIVO omvivo.com A Schiavello Complex, Door 94, 1 Sharps Rd, Tullamarine Vic P 03 9339 8130 E info@omvivo.com I @omvivo 106 COMPLETEHOME.COM.AU
PRODUCT P OW DE R ROOM S PECI AL IST S W hy be traditional? Be di΍erent and exciting 01 when renovating your powder room! Renovating this space brings a unique set of challenges; it’s often the smallest room in the home, so it requires expert design knowledge and the ability to execute a quality build to ensure a fabulous end result. Brindabella Bathrooms specialises in powder room designs and renovations that not only look amazing, but are highly functional, with unique touches that are often surprising yet work brilliantly. Most bathroom renovators will automatically recommend a full wall of tiles for your powder room and, while that can work in some circumstances, Brindabella Bathrooms applies its specialist knowledge to utilise a range of surface solutions that you may not have considered. 01 Tiles don’t always have to be ceramic. In this example, Brindabella Bathrooms used tiles made from 100-year-old reclaimed hardwood from decommissioned boats. This has created a strong visual aesthetic and has provided an environmentally friendly and sustainable solution for the owners. BATHROOM IDEAS 107
03 02 02 Venetian plaster has been used in place of tiles in this example. Venetian plaster is an eco-friendly product created by a unique blend of slaked lime, marble dust and natural pigments, meticulously layered and polished to create a smooth, luminous surface. These products are easily accessible and sustainable, making Venetian plaster an a΍ ordable option for many homeowners. The ȴ nish not only mimics the look of classic Italian architecture, but also reȵ ects light in a way that enhances the ambience of the room. In a bathroom setting, the plaster’s inherent water resistance makes it an ideal choice, ensuring durability and longevity. 03 Another great option is wainscoting, a decorative wall treatment, as seen in this example. Wainscoting not only adds a touch of sophistication to your bathroom, but also introduces a sense of classic architectural elegance. This functional element ensures durability while e΍ortlessly enhancing the overall design scheme. 108 COMPLETEHOME.COM.AU
PRODUCT 04 04 Or why not include a wallpaper feature? Wallpaper is experiencing a resurgence of popularity and, particularly when applied in a powder room environment, can be incredibly visually e΍ective, creating atmosphere and excitement in even the smallest of rooms. BRINDABELLA BATHROOMS brindabella.net.au A 3/30 Leighton Pl, Hornsby NSW (by appointment only) P 1300 794 488 E reception@brindabella.net.au F @brindabellarenovations I @brindabellarenovations BATHROOM IDEAS 109
S T YLE MEETS T ECH 110 COMPLETEHOME.COM.AU
PRODUCT The Glyde shower range by Greens Tapware should be on the top of your list of fixtures to check out Your daily shower isn’t just for cleanliness – it’s a form of self-care too. That’s why it’s so important to choose the right shower for the job, to help you be the best version of yourself. If you’re in the process of renovating your bathroom, the Glyde shower range by Greens Tapware should be on the top of your list of ȴxtures to check out. The new Glyde Syntra shower with RainBoost® technology is among the most impressive of the range. Known for facilitating showers as perfect as a good night’s sleep, the RainBoost® shower technology has been speciȴcally designed to allow for varying water pressure conditions. It has been engineered to maximise BATHROOM IDEAS 111
112 COMPLETEHOME.COM.AU
PRODUCT shower ȵow and coverage out of low-pressure water systems down to 10kPa, as well as performing well on high-water-pressure systems. For unrivalled performance on low pressure or gravity-fed systems, it’s best to combine the Glyde Syntra with a Greens shower mixer with a low-pressure cartridge. Available in a soft square design in twin rails, hand showers, ceiling showers, wall showers and single-rail options in brushed brass, chrome, brushed nickel, gun metal and matt black, there’s a Glyde Syntra option to suit every bathroom design’s style and colour palette. GREENS TAPWARE NZ greenstapware.com A 22 The Boulevard, Te Rapa Park, Hamilton NZ P 0800 655 455 E info@greenstapware.com F @greenstapwarenz I @greens_tapware_nz GREENS TAPWARE AU greenstapware.com A 36 Naxos Way, Keysborough Vic P 1800 244 487 E info@greenstapware.com F @greenstapwarenz I @greens_tapware_nz BATHROOM IDEAS 113
ITA LY W I TH IN RE AC H Mediterranean style is within reach with high-quality Italian porcelain and cutting-edge Italian-designed vanities from Disegno Casa. For more than 25 years, Disegno Casa has been providing stylish bathroom products that allow customers to choose excellence and elegance at a price they can a΍ord. The company’s tiles, bathroom vanities and porcelain slabs are durable, built to stand the test of time, with classic Italian designs that are timeless and chic. Disegno Casa goes beyond its o΍ering of high-quality products by also collaborating with customers to design the bathroom of their dreams. From intricate tiles to sleek porcelain slabs, Disegno Casa elevates the ordinary bathroom into a realm of captivating ambience and unparalleled versatility. 114 COMPLETEHOME.COM.AU
PRODUCT BATHROOM IDEAS 115
PRODUCT DISEGNO CASA disegnocasa.com.au A 162 Fulham Rd, Alphington Vic P 03 9482 6054 F @disegnocasa I @disegnocasa_melbourne 116 COMPLETEHOME.COM.AU
PRODUCT C LA SS IC P RECI SIO N BATHROOM IDEAS 117
Crafted with precision, Verona tapware by Oliveri Solutions brings that touch of chic to your bathroom. A curved uplifted paddle lever adds elegance to a classic design – the perfect ȴ t for a bathroom that exudes sophistication. With a natural brass ȴnish, the Verona range is available in gunmetal, classic gold, chrome, matt black, brushed nickel and white. Lead-free and boasting a ȴ ve-star WELS rating, Verona guarantees eco-conscious usage without compromising on style. Oliveri is committed to safety and wellbeing, with the lead-free composition minimising both the impact on the environment and any health concerns that lead taps can pose. Interchangeable trim kits allow for versatility as you can easily switch out the appearance of ȴ xtures without needing to replace them entirely. Not only is this coste΍ective in the long run, it allows you to stay up to date with the aesthetic you desire. OLIVERI SOLUTIONS oliveri.com.au A 51 Naweena Rd, Regency Park SA P 07 8348 6444 F @oliverisolutions I @oliveri_solutions 118 COMPLETEHOME.COM.AU
PRODUCT BATHROOM IDEAS 119
PROFILE MAS T ER S HOWRO O M Hardware & General ȴrst opened as a corner hardware store in 1960, and has expanded along Winbourne Road, Harbord Road and Pittwater Road into 20 specialist sales centres inbBrookvale. The company’s renovated and redesigned bathroom showroom and adjoining tap show-room have an incredibly impressive depth of choice in brands and products in varying price ranges, meaning products can be compared and contrasted before being locked in. What stands out the most when entering the bathroom showroom are the inspirational bathroom concept spaces, which are styled to help you visualise your renovation and ȴnd the perfect products for it. You can even exercise your creativity and design your own The Block-inspired bathroom looks, thanks to Hardware & General’s vast range of Dulux paints, Velux skylights, tiles, taps, toilets and lighting. Many members of the Hardware & General showroom team available to help you have worked for the company for more than a decade, meaning they are industry specialists. T heir product and technical knowledge is second to none and their deep understanding of projects and associated procedures allows for the proactive solving of problems before they impact the project. Hardware & General’s Brookvale bathroom showroom boasts a range of products by an impressive range of brands including Caroma, PARISI, PARISI Furniture, Marquis, Argent, ADP, Decina, Duravit, Bathe, Kaldewei, Hansgrohe, Villeroy & Boch, Gessi, Abey, Astra Walker, Turner Hastings, Bette, Dorf, Methven and many more. HARDWARE & GENERAL hg.com.au A 68 Winbourne Rd, Brookvale NSW P 02 8456 1188 Additional showrooms A 24–32 Forge St, Blacktown NSW P 02 8834 5200 A 60 Darley St, Mona Vale NSW P 02 9997 1711 A 107–109 Boundary Rd, Peakhurst NSW P 02 9533 4466 120 COMPLETEHOME.COM.AU
Bathroom ;<=,17 .:-JI\PZWWU ZMVW^I\QWV O]QLM :MILa\W\ZIV[NWZUaW]Z^Q[QWV\WZMITQ\a' >Q[Q\W]Z[PW_ZWWU[\WM`XMZQMVKMQUUMZ[Q^MLQ[XTIa[\PI\_QTT \ZIV[NWZUaW]ZKWVKMX\WN _PI\I[\aTQ[PJI\PZWWUKIVJM 0IZL_IZM/MVMZITQ[ITWKITNIUQTaW_VMLKWUXIVa_Q\PaMIZ[WN  M`XMZQMVKM7]ZM`XMZ\[IZM_IQ\QVO\WO]QLMIVLPMTXaW]ÅVLXMZNMK\ LM[QOV[WT]\QWV[NWZaW]Z[XMKQITXZWRMK\+WUM[MM\W]KPIVLKWUXIZM IZIVOMWN WX\QWV[\PI\_QTTITTW_aW]\WUISMKWVÅLMV\LM[QOVKPWQKM[ IVL\ZIV[NWZU\PM_IaaW]TQ^M 4QOP\QVO *I\PZWWU[ download <IX[ <QTM[ Bathroom, Tap & Tile Showrooms 60 Darley St Mona Vale. 9997-1711 68 -75 Winbourne Rd Brookvale. 8456 1188 hg.com.au
F U N CT I ON AL DE S IGN , VI SUA L E XC EL L E N CE With Johnson Suisse, part of the esteemed Roca Group, you’re in capable hands. As the global leader in bathroom manufacturing, Roca Group is supported by 76 factories in more than 170 markets worldwide. With manufacturing capabilities and design centres around the world, Johnson Suisse can respond to the needs of the Australian market with their exceptional product design. Across the company’s extensive range you are sure to ȴnd the perfect blend of functional design and visual excellence, with an innovative approach to design and manufacture. Johnson Suisse’s Inspired designs are created for Australian life. The latest addition to their product range is the Listo Smart Toilet, in which technology and water take centre stage, bringing hygiene and comfort to a new dimension. With an LED night light, presence sensor, self-cleaning nozzle and simple side panel for washing and drying the toilet. Johnson Suisse Listo Smart Toilets have an Integral High Hazard Backȵow Prevention device which complies with the requirements of AS 2845.2 (1996 and 2010) and AS/NZS 3500.1. Meaning no additional RPZ valve is required. 122 COMPLETEHOME.COM.AU
PRODUCT BATHROOM IDEAS 123
PRODUCT The Venezia Collection’s tapware and shower range is available in ȴ ve colours (Chrome, Matte Black, Gun Metal, PVD Brushed Nickel or PVD Brushed Brass) so you can ȴnd the perfect tone for your space. Venezia’s bath range o΍ers the epitome of bathroom luxury, from curved freestanding, back-to-wall or corner baths. Australian-made shower bases and screensbalso o΍er the ȴnest in design and quality. Johnson Suisse services all segments of the Australian market, from residential and commercial construction (meeting AS1428.1 standards), to DIY and home renovations through a wide network of specialty outlets and bathroom stores. You are supported every step of the way thanks to local teams on the ground, as well as market leading industry warranties. This ensures your bathware will stay looking its best for many years to come. JOHNSON SUISSE johnsonsuisse.com.au P 1300 717 717 F @JohnsonSuisseAustralia I @johnsonsuisse_australia 124 COMPLETEHOME.COM.AU

STO RM TECH MAKE S WAVE S AT AUST R AL IAN GO OD D E SIGN AWARD S T here is design, and then there is good design – driven by innovation, genuine human insight, and consideration for the impact the product will have both on the lives of its users and the environment overall. In the world of architecture and design, there hasn’t been a visual symbol that would be more emblematic of these qualities than the now iconic Good Design Tick. Awarded annually since 1958 as part of the prestigious Australian Good Design Awards program, the symbol has been synonymous with design excellence for over six decades now, rewarding bold thinkers, tinkers and creators who aspire to create better products, better experiences and a better future in Australia and globally. On Friday 8 September 2023, in the company of more than 1000 esteemed guests from the industry, Stormtech was announced as one of the winners of this year’s awards. A passionate family enterprise turned leader in the ȴeld of high-quality drainage, today Stormtech is the architect and designer’s favourite and its latest product, Wave Grate, further exempliȴes why the brand has become the industry’s go-to. The pioneering product, designed by Stormtech’s Troy Creighton and Peter Tucker, was recognised for its remarkable, innovative and unique quality and scored the distinguished Good Design Award Winner accolade in the Product Design category. “The Wave Grate is a stylish and functional product that has clearly incorporated a new approach to manufacturing and design,” the statement from the jury reads. “Achieving a patented design is highly commendable and a clear reȵection of its innovation. Well done on a beautiful and seamlessly integrated design!” Designed and manufactured in Australia, with Australian-sourced and -processed aluminium, the Wave Grate’s beautiful design cleverly conceals drainage channels for a perfect integration. The product fuses exquisite functionality with a stunning, pared-back and unpretentious form – a clear expression of the brand’s DNA, which, Stormtech managing director, Troy Creighton, remarks, doesn’t include half-measures. 126 COMPLETEHOME.COM.AU
PRODUCT “What we’ve learnt over the last three decades is that the design needs to be as simple as possible, yet provide multiple beneȴ ts to di΍erent stakeholders,” explains Troy. His desire to ensure the product didn’t compromise on the quality, functionality, sustainability proȴle, nor the aesthetics meant Wave Grate was developed based on decades of experience and designer and customer feedback. It is quite clear that this commendable dedication to design excellence and unwavering commitment to innovation have paved Wave Grate’s way to the accolade in the Product Design category. “The award represents the culmination of a project Stormtech put together in response to feedback from designers, installers and end users,” Troy remarks on the win. “This culmination was satisfying in and of itself as the quality and aesthetic are self-evident. However, recognition from the Australian design community in such a way is a massive compliment to our design and engineering prowess as a team.” “To be recognised with an Australian Good Design Award tells the world this project not only represents design excellence, but it also surpasses the criteria for design innovation and design impact,” says Dr. Brandon Gien, CEO of Good Design Australia and Chair of the Australian Good Design Awards. “The award is an independent endorsement of professional design quality.” STORMTECH stormtech.com.au P 1300 653 403 E info@stormtech.com.au F @stormtechdrains I @stormtechdrains BATHROOM IDEAS 127
02 01 TUB TIME Make your favourite bathroom fixture the centrepiece of your dream wet room 04 curated by nicole mulloy 03 128 COMPLETEHOME.COM.AU
CREATIVE EDIT 05 06 BATHROOM IDEAS 129
CREATIVE EDIT 07 08 09 01 Innova Nirvana freestanding bath. bestlink.com.au 02 Marina back-to-wall bath. drench.co.uk 03 Studio 1 Haven freestanding bath. harveynorman.com.au 04 Lune freestanding bath. omvivo.com 05 Villa bath in White. omvivo.com 06 Victoria + Albert Seros bath. houseofrohl.com 07 Victoria + Albert Corvara bath. vandabaths.com 08 Urbane II back-to-wall bath. caroma.com.au 09 Antique Copper Bateau bath. wittandberg.com 10 Victoria + Albert Lussari bath. vandabaths.com 10 11 Diamond faux marble freestanding bath. maisonvalentina.net 11 130 COMPLETEHOME.COM.AU
CREATIVE EDIT BASIN BO N AN Z A 01 From single to double, circle to trough, wall-hung to countertop, the breadth of choice for basins is astounding BATHROOM IDEAS 131
02 03 04 05 curated by nicole mulloy 01 Elvire wall-hung basin with timber shelf. caroma.com.au 02 Urbane II inset basin. caroma.com.au 03 Countertop Pill basin in Teal. noodco.com.au 04 Wall-hung Bowl basin in Pastel Peach. noodco.com.au 05 Kiln360 ceramic basin in Rivergum. robertgordoninteriors.com 06 Marrakech wall basin. omvivo.com 07 Victoria + Albert Seros freestanding basin. houseofrohl.com 08 Lune oval basin. omvivo.com 09 Stadium Sub undermount basin. omvivo.com 10 Victoria + Albert Seros countertop basin. houseofrohl.com 132 COMPLETEHOME.COM.AU
CREATIVE EDIT 06 07 08 10 09 BATHROOM IDEAS 133
CREATIVE EDIT 01 02 Top off your fixtures with fittings that serve as the jewel in your bathroom crown curated by nicole mulloy 04 03 134 COMPLETEHOME.COM.AU 05
T UR N U P T HE STYLE 06 BATHROOM IDEAS 135
CREATIVE EDIT 07 08 01 Agape Memory ȵoorstanding spout for basins. artedomus.com 02 Round Cross Handle tapware in Champagne. meir.com.au 09 03 Agape Memory ȵoorstanding spout for baths. artedomus.com 04 Reȵex tapware by IB Rubinetti. pacojaanson.com.au 05 VOLA 111 basin mixer. en.vola.com 06 VOLA 520 in Matt White. Image Piet Albert Goethals. en.vola.com 11 07 Cromford tapware collection. phoenixtapware.com.au 08 ELIO tapware by IB Rubinetti. pacojaanson.com.au 09 Agape Memory Progressive tap. artedomus.com 10 Crosswater MPRO ȵoorstanding bath mixer. drench.co.uk 11 Teel wall mixer set. phoenixtapware.com.au 10 136 COMPLETEHOME.COM.AU
COMPLETEHOME Inspiration room by room SEE the latest trends, inspiration and projects from the country’s top designs and creatives D IS COVE R the latest products ME ET the leading professionals who can help BE GI N your renovation, no matter how big or small 100% AUSTRALIAN
INDEX NATIONAL Bella Vista ....................................................................................................... 101 Bestlink International ................................................................................. 10 Greens Tapware ..................................................................................... 17, 110 Johnson Suisse ..................................................................... 13, 122 Kitchen& Bathroom Designers Institute of Australia .... 72, 77 Modulr+ .......................................................................................... 39 Oliveri Solutions ............................................................... 117, OBC Omvivo .............................................................................. 8, 60, 104 Stormtech ........................................................................... 125, 126 Brindabella Bathrooms ........................................................ 4, 107 NSW Comfort Heat ................................................................................... 3 Bathrooms by Oldham ......................................................... 94, 97 GT&B .................................................................................. 19, 80, 90 138 COMPLETEHOME.COM.AU Designline Kitchens & Bathrooms ......................................... 139 Hardware & General ........................................................ 120, 121 Impala Kitchens & Bathrooms ............................................. 6, 84 QLD Stocks Appliances ......................................................................... 15 VIC Disegno Casa ........................................................................ 93, 114 Oceano Bathroom ........................................................................ 83 Rosemount Kitchens .................................................................... 87

Superior Quality and Design Oliveri has been designing and manufacturing products in Australia since 1947. Our proud heritage is based on consistently high quality products across kitchen, bathroom and laundry, expertly designed to elevate your everyday, always with a focus on quality and contemporary design. oliveri.com.au | sales@oliveri.com.au oliveri.com.au